KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234625Help
Entry
112234625         CDS       T05605                                 

Definition
(RefSeq) adenylosuccinate synthetase isozyme 2-like
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw00250  Alanine, aspartate and glutamate metabolism
otw01100  Metabolic pathways
Module
otw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112234625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112234625
Enzymes [BR:otw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     112234625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 112234625
NCBI-ProteinID: XP_024258629
Position
Unknown
AA seq 459 aa AA seqDB search
MSESRRKDAAQNGAAHSTSTEPHVARPNVGNRVTVVLGAQWGDEGKGKVVDLLAQDADIV
CRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPKVTAFIGNGVVIHLPGLFEEAEKNMRKG
KSLVGWDKRLIISDRAHIVFDFHQAVDGVQEQQRQEQAGKNLGTTKKGIGPVYSAKAARS
GLRICDLMSDFTQFSERFKVLASQYQSMYPTLEIDIDGELCKLKDYVEKLKHMVKDGVFY
MYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVV
KAYTTRVGIGAFPSEQFNDVGELLQTRGKEVGVTTGRKRRCGWLDLVLIKYAHMINGFTA
LALTKLDILDVLPEIKVGVSYSVDGENIPNFPANQEVLQSVEVQYATLPGWNSDTSAIRT
FDELPENAQKYVRYIEEHLGVPVKWIGVGKSRESMIQIF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagagccggagaaaagatgctgcgcaaaacggtgcagcccatagcactagtaca
gagccacacgtggccagaccaaatgttggcaacagggtgactgtagtgctaggggctcaa
tggggcgacgagggcaaagggaaagttgtggacctgctcgctcaggacgccgatattgtt
tgcagatgccagggtggtaacaatgcaggacacacggtggtggtggactctgtcgagtat
gacttccaccttctacccagcggcattatcaaccctaaggttactgctttcattggtaat
ggggtagtgatccacctgcctggcctctttgaggaggctgagaagaatatgcgcaaaggc
aaaagtttggtgggctgggacaagaggctgatcatttcagaccgagcacacattgtgttt
gatttccatcaagcggtcgacggtgtgcaagagcagcagagacaagagcaagcgggcaag
aacctcggaacaacgaaaaaggggattggcccagtgtactcagccaaagcagcccgcagc
ggcctccggatatgtgacctcatgtctgacttcacgcagttctctgaaagatttaaagtc
ttagcctcgcagtatcagtctatgtacccgaccctggagattgacatcgatggagagttg
tgcaagttgaaggattacgtggagaagttaaagcatatggtgaaagatggcgtcttctac
atgtacgaggccctacatggacctcccaaaaagatcctggtagaaggagccaacgctgcc
ctcttagatattgactttggaacgtaccctttcgtgacctcgtctaactgcacagtaggc
ggggtgtgcacgggcctaggcatgccgccgcagaacgtgggtgaggtgtacggcgtggtc
aaggcctataccacccgggttggcatcggagcctttccctctgagcagttcaatgacgtt
ggggagctcctgcagacgaggggaaaagaagtgggtgtgaccacgggccgtaaaaggaga
tgcggttggctggacctcgtgctcatcaaatatgcccacatgattaacggcttcactgcc
ttagctctcaccaagctagacatcttggatgtgctccctgagatcaaagttggtgtgtca
tactctgtggatggtgaaaatatacctaattttccagccaaccaggaagtcttacaaagt
gttgaggttcagtatgccaccctgccaggttggaacagtgacacctctgccatcagaacg
ttcgatgagctgccagagaacgcccagaaatatgtccgctacattgaggagcacctcggt
gtgcccgtgaaatggattggagtcggaaaatctcgggagtccatgatccagatcttttaa

DBGET integrated database retrieval system