KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234772Help
Entry
112234772         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112234772
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112234772
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112234772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 112234772
NCBI-ProteinID: XP_024258839
Position
Unknown
AA seq 1271 aa AA seqDB search
MANESPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSTGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFCSFIEGSLVKNYTQRPPTDQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEEAQEQEGEPSSIVNQPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQDDKRRMEEVERRRKEEEERRRAEEEKRRADREQEYIRRQLEEEQRHLE
ILQQQLLHEQAMLLVRPNSADERYRKNIQGSPQAAQVKVQPPVPPRAAETIANGNTPIAV
QPAMQRPMEPQVPVRTTSRSPVLSRRDSPLHGNSNATPNNPAGQRNACSAAAEPRLLWER
VEKLVPRPTSGSGSTCSSSGSSNSSSQPSSHSGSGERFRARSSSKSEGSPLQHPEHAGKK
PEERKESVRTNRLADLTASANELRVVEDVQRPHKVTDYSSSSEESGTTDEDEDDEEVDQE
GGEESTSGPEDSHAVSSRLSNGEMESVKTLIVHVEGESDSKTTPCKDDTLIVRQSTGDNK
KRPAPSPGHGPVPGFNTSPRLIRPALQGHPGLQGHQEKNGFVGRIHLLPDLIQQSHHSPS
SSASSSPSSSSMTSPTMSMSPQSPLDKLSILLESHSVSNTMQKHKSSSSFTPFIDPRLLQ
VSTSGAALNNLAFGNDARLAEALRADPSRKGSVVNVNPVNTRPQSDTPEIRKYKKRFNSE
ILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKNK
LRVYYLSWLRNKILHNDPEVEKKQGWVTVGDLEGAVHYKVVKYERIKFLVLALKNSVEVY
AWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSSNGFHAVDVDSGAVYDIY
LPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYI
RSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGASQVYF
MTLGRTSLLSW
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgagtctccagctaaaagtctagtggacatagaccttgcctctttgcgggac
ccagctggtattttcgaactggtggaagtggtcggcaatggtacctatggacaagtatac
aagggccgacatgtcaagacaggacaactggcggccatcaaggtcatggacgtcacagag
gatgaagaggaggagattaaactggagattaatatgctgaagaagtactcccaccacaga
aacatagccacctactacggagccttcatcaagaaaagccccccaggacacgacgaccag
ctatggctggtgatggagttctgtggtgcaggctccatcacagaccttgtgaagaacacc
aagggcaacacactgaaggaggactggatcgcctacatctctcgtgagatcctcaggggg
ttggctcacctacacgcccaccatgtgatccaccgtgacatcaagggccagaacgtgctg
ctgactgagaacgcagaggtcaaactagtggacttcggtgtgagcgcccagctggaccgg
acagtgggtaggaggaacaccttcattggtacgccctattggatggcgcccgaggtcatc
gcctgcgacgagaacccagacgccacctatgactacagaagtgacttgtggtccactgga
atcacagctatagagatggctgagggagctcctccgctgtgcgatatgcatccaatgaga
gctctcttcctcatccccagaaaccctcctcctcgactcaagtcaaagaaatggtctaag
aagttttgcagcttcatcgagggctccctggtgaagaactacactcagcgcccccccacc
gaccagctgctgaaacaccccttcatcagagaccagcccaacgagaggcaggtccgcatc
cagctcaaagaccacatcgaccgcaccaagaagaagaggggggagaaggatgagaccgag
tatgagtatagcgggagtgaggaagaggaggaggaagctcaggagcaggagggggagccc
agctccatagtgaaccaaccaggggagtcaaccctgcgtagggatttcatccgtctgcag
caagagaacaaggagcgctcagaggccctgcgcagacagcagctcttgcaggagcagcag
ctccgggagcaggaggagtacaagcgccaactactggcagagaggcagaaacgcatcgag
cagcagaaggagcagaggaggaggctggaggagcaacaacgtcgtgagcgggagatgagg
aggcagcaggagcgcgagcagcgtcgccgggagcaggatgacaagaggcgtatggaagag
gttgaacgccggcgtaaagaggaggaggagcgcaggagggctgaggaggagaaaaggagg
gctgaccgggagcaggagtacatccgtcgccagctggaggaggagcagaggcacctggag
atcctgcagcagcagctgctccatgaacaggccatgctactggtgagaccgaactctgct
gatgagaggtaccgtaagaacatccaaggttctcctcaggccgcccaggttaaggttcag
cccccggttcctccccgcgccgccgagaccatcgccaatggaaacacccccattgctgtc
cagcctgccatgcaaaggcccatggaaccccaggttcctgtgaggacaacgtccaggtct
ccagtactgtcacgcagggactctcctctacatggcaactccaatgccacgcctaacaac
ccggcgggccagaggaacgcctgcagtgctgcagcagagccgcgtctgctgtgggagcgg
gtggagaaactggttcccaggccaacgagtggcagtggtagtacttgcagctcctccggc
tccagtaactccagctcccagcccagctctcacagtggctcaggggagaggttcagagcc
cgctcctcatcaaagtctgagggttctccccttcagcatccagagcatgctgggaaaaaa
cctgaggagaggaaggagtctgtcagaactaaccgactggcggaccttaccgcgtcggcc
aacgagcttcgtgtggtggaggacgtgcaacgccctcacaaggtgacagactactcctca
tctagtgaggagtcggggaccacggatgaggatgaggatgatgaagaggtagaccaggag
ggaggagaggagtctacctcaggaccagaggactctcacgctgtctcctccagactaagc
aacggagagatggaatcggtgaagaccttgatcgttcacgtcgagggcgagagtgactct
aaaaccacaccctgtaaagatgacactctgatcgtcagacagagtacaggtgacaacaaa
aagcgacctgcccccagccctggtcatggccctgtccctgggtttaacactagccccagg
ctgattcgccctgccctccaaggccaccctggtctccaaggccaccaggagaaaaatggc
tttgtgggccgcattcacctcctgcctgacctgatccagcagagccaccactccccctcc
tcctctgcctcctcctctccctcctcctccagcatgacgagccccaccatgtccatgtcc
ccccagagccccctggacaagctcagcatactcctggagagtcattctgtcagcaacaca
atgcagaaacacaagtcctcctcctccttcactccttttatcgatccacgcctcctccag
gtctctacatccggcgcagctctcaacaacctggcttttgggaacgatgccaggctggcg
gaggcactgagggcggacccgtcacgtaaaggctccgtggtcaatgtgaaccctgtcaac
acacggccgcagagtgacaccccagagatccgcaagtacaagaagaggttcaactctgag
atcctgtgtgctgcgctctggggagtgaacctgctggtggggacagagagtggtctgatg
ctgctggatcgtagcggtcaggggaaggtgtatcccctcatcagccgacgccgcttccaa
caaatggatgtcctagagggactcaacgtcctggttactatatcaggcaagaagaacaag
ttgcgtgtgtactatctgtcctggttgaggaacaagatcctgcacaacgaccctgaggtg
gagaagaagcagggctgggtcactgtgggtgacctggagggtgctgttcactacaaagtt
gtgaaatacgagaggatcaagtttttggttttggccctgaagaactcggtggaggtctat
gcatgggcaccgaaaccctaccacaagttcatggctttcaagtcgtttggtgacctggtg
cacaagcccctgctggttgacctgacggtggaggaaggtcaaaggttaaaggtaatctat
ggctccagtaacggatttcatgctgtggacgtggactcaggggccgtctacgacatctac
ctgcccacccatatccagaccagtatccagtcccatgccatcatcatcctgcccaacaca
gatggcattgagctgctggtgtgttacgaggacgagggtgtctatgtcaacacctacgga
cgcatcaccaaggacgtggtgctgcagtggggcgagatgcccacttctgtggcctatatc
cgttctaaccagataatgggctggggggagaaagccatagagatcagatctgtggagact
ggacatctcgacggagtcttcatgcacaagagagcccagagactcaagttcctgtgtgag
aggaacgacaaggtgttctttgcctcggtgcgatccggaggagccagccaggtgtacttt
atgaccctggggcgcacctctctgctcagctggtag

DBGET integrated database retrieval system