KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236283Help
Entry
112236283         CDS       T05605                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112236283
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112236283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 112236283
NCBI-ProteinID: XP_024260631
Position
Unknown
AA seq 694 aa AA seqDB search
MSSLASAERRAFALKINRHSSAEIRRHFGGNYGSPQVSKQHSRHSSNASVSTCSTVPQSY
DAVEPLDLEEFLMSQLQSGDSALMQELGDFPDDDLEVELVEKECRTVRHSVPEEGVELDS
HVRDCVQSYTQPWLMVSRSPVKSPSLAVLSDDSSRTLTSSDFDLRSGLTPDPRVEGLLHF
SNHDDLDRFNQEARQGNRHPELFALYPPADEDDAVEIRPIPDCPKEHMGDRIIIRCQAIK
FEIDIEPLFATLALYDLREKKKISENFYCDLNSDQFKGFLKPHTPQTDHSTLSRAAIFSI
TYPSPDIYLVIKIEKVLQRGEISDCAEPTWSGRDGLSKEKRRKLRNQSEMFCQRLGRYRM
PFAWATVNIMNVSSAATLDRDTTDLTASTCKSSSLEKRGQLPRRNSERFGTMEDQCNMSA
FKPATITISTFCKQEGDRLSDEDLFKFLADIKKFSSLQRRIKTIPGTIRLDVTPVHDNPV
ACLSTELIPVKPLAEKNVRPVKEVLEFPSSEVYVPHSTYRNLLYIYPQRLNFVNRLTSGG
RNITIKIQFMSGEDPSCVMPVIFGKSNGPEFVQEVYTPVTYHNKSPDFYEEVKMVLPARL
TERHHLLFTFYHISCQQKQNQTGASETLIGYSWLPILSTDRLQTGQYCLPIALDRLPVNY
SLHSPERITPQVPPVKWRESHKEFSTWRYRLCPQ
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttggcgagcgcggagcgacgtgcgttcgctctgaaaatcaacagacactcg
tctgctgagatcaggagacacttcggtgggaactatgggtccccccaggtctccaagcaa
catagtcgtcacagctccaacgcatcagtctccacttgctccaccgtgccccagtcatat
gacgcggtggagcccttggacctggaagagtttctgatgtcacagctacagagtggagac
tccgccctcatgcaggagcttggagatttccccgacgacgacctggaagtagaactggtg
gagaaggagtgtcggaccgtacgccactctgtgccggaggagggggtggagttggattcc
catgtcagggactgtgttcagagttacacccaaccctggctgatggtcagcaggagtcca
gtgaagtccccgtccctggcggtactgagtgatgactccagcaggaccctgacctcctct
gactttgacctccgctctggtctgacccctgaccccagagtggaggggctgctgcacttc
agtaaccatgacgacctggacaggttcaaccaggaagcccggcaggggaaccgccaccct
gagctgtttgccctgtacccacccgccgacgaggatgatgcagtggagatccggcccatt
cccgactgtcccaaagagcacatgggcgaccggatcatcatccggtgtcaggccatcaag
tttgagattgacattgaaccactatttgctaccctggctctgtacgacctgagagagaag
aaaaagatatccgagaacttctactgtgatctgaactcagaccagtttaaagggttcctg
aaaccccacacgccacagacggaccactccaccctctcccgagcagccatcttctccatc
acatacccctccccagacatctacctggtcatcaagatagagaaggtgctgcagcgcgga
gagatcagtgactgtgcggaacctacatggtcaggaagggacggactcagcaaggagaag
cggaggaagctgcgtaatcagtctgagatgttctgtcagagacttggtcgctaccgcatg
ccctttgcctgggctacagtcaacatcatgaacgtctcgtcagccgccacactggaccga
gacaccaccgacttgacagcctcaacgtgtaaatccagcagtctggaaaagagaggtcag
ttgcccaggaggaactcagagaggttcggtaccatggaagaccagtgtaacatgtctgcc
ttcaaacctgctaccatcaccatcagcaccttctgcaagcaggagggggaccgtctgagt
gatgaggacttgtttaagttcctggcagacatcaagaagttctcatccctgcagagaaga
attaaaaccataccaggtacaataagactggatgtgactccggtccatgacaacccagtg
gcctgtctgtctactgagctgatcccagtcaaaccactggctgagaagaacgtccgacct
gtcaaagaggtgttggagttcccctccagcgaggtctatgttccacacagcacttacagg
aacctgctctacatatacccccagcgactcaactttgtcaacaggctgacttcaggagga
aggaatatcactattaaaatccagtttatgagtggagaagaccccagctgtgtgatgcct
gtcatttttggaaaatcgaatggtcctgagtttgtgcaggaagtatacaccccagtcacg
taccataacaagtctccagacttctatgaggaggtgaagatggttctgcctgccaggctg
actgagagacaccacctgctgttcacattctaccacatcagctgtcaacagaaacagaac
cagactggagccagtgagacactcatcggttactcttggctgcctatactgagtactgac
agactacagactggtcagtactgccttcctatcgccctggacagattgcctgtcaactac
tcactgcactcacctgagaggattacccctcaggttcctccagtcaagtggagggaaagt
cacaaggagttttcaacctggagatacaggctgtgtcctcagtaa

DBGET integrated database retrieval system