KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236543Help
Entry
112236543         CDS       T05605                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00450  Selenocompound metabolism
otw00970  Aminoacyl-tRNA biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    112236543
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    112236543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:otw01007]
    112236543
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:otw03016]
    112236543
Enzymes [BR:otw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     112236543
Amino acid related enzymes [BR:otw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   112236543
Transfer RNA biogenesis [BR:otw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    112236543
 Prokaryotic type
   Other AARSs
    112236543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 112236543
NCBI-ProteinID: XP_024260904
Position
Unknown
AA seq 746 aa AA seqDB search
MVPERQHPILPQEGKRNVLVTSALPYVNNVPHLGNIIGCVLSADVFARYGRLRGWNVLYV
CGTDEYGTATENKAREEGLTAQQICDKYHAVHASIYQWFQVDFDFFGRTTTKKQTEIAQN
IFWRLHERGFLLEDIVEQLRCEACQRFLADRFVEGTCPFCSYPEARGDQCDKCGKLINAV
ELREPTCKVCSQTPVVQSSKHLFLDLPKLEAELEQWLERSTGSGDWTANAKQITRSWVRD
GLKPRCITRDLKWGTPVPHPDFSDKVFYVWFDAPIGYLSITANYTDQWEKWWKNPQQVEL
YNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLVATEYLNYEDTKFSKSRGVGVFGDMAK
DTGVPSDVWRFYLLYLRPEGQDSAFSWVDMATKNNSELLNNLGNFINRAGMFVSKFFESC
VPAMALQQEDKRLLAQVGWELKQYINLMDRVKIRDALKCILNISRHGNQYIQVNEPWKKI
KGDETDRQRSGTVTGVSVNVACLLSVMLQPYMPTVSHTIRQQLNAPPSVTGTLLQGTGNF
VCSLPVGHHIGTVSPLFQKLESEQIESLKKRFGGQQPKTTAQPATTPASDPAAQTAVNGA
DAERARELTLAVAEQGEKVRTLKGQKAEKTVIGAEVTKLLELKKQLSLAEGKDPEPVLTK
GKTTAQPATTPASDPAAQTAVNGADAERARELTLAVAEQGEKVRTLKGQKAEKTVIGAEV
TKLLELKKQLSLAEGKDPEPVLTKGK
NT seq 2239 nt NT seq  +upstreamnt  +downstreamnt
atggttccagagagacaacaccctattcttcctcaggagggcaagaggaacgtcctagtg
accagtgccttgccttatgttaacaacgtccctcatctgggcaacatcatcggctgtgtg
ctcagcgctgacgtctttgccaggtatggtcgtctgcgtggttggaatgtactgtatgtg
tgtgggactgatgagtacggcacagctacagagaacaaggcccgtgaggaaggtctgaca
gcgcagcagatctgtgacaagtaccatgctgtccacgcctccatctaccagtggttccag
gtggacttcgacttctttggccgcaccaccacaaagaaacagactgagatagcccagaac
atcttctggcgtctccatgagcgaggcttcctacttgaagacattgtggagcagctgcgc
tgcgaggcgtgccagcgttttctagccgaccgcttcgtcgagggaacatgtcccttctgc
tcttacccagaggcccgaggggaccagtgtgacaagtgtggcaagcttatcaacgctgtg
gagctacgggagcctacttgtaaggtgtgtagtcagactcctgtagtccaatcctccaaa
cacctgttcctggacctgcccaagttggaggctgagttggagcagtggttggagaggtct
actgggtcaggggactggacggccaacgccaaacagatcaccagatcctgggtgagggac
ggactcaaaccccgctgcatcaccagagacctgaagtggggaacccctgtacctcacccc
gacttctctgacaaggtgttctacgtgtggtttgacgctcctattggttacctgtccatc
acagccaactacactgaccaatgggagaagtggtggaagaacccacagcaggtggagctg
tataacttcatggccaaggacaatgttccgttccacagtgtggtgttcccctgctctcta
ctgggagcacaggacaactacacactggtcaaccacctggtggctacagagtacctgaac
tacgaggacaccaagttctctaagagtcgaggtgttggtgtgtttggtgacatggccaag
gatacgggcgtcccctctgacgtgtggcgattctacctgctgtacctccgtcccgaggga
caggactcggccttctcctgggtcgacatggccaccaagaacaactctgagctgctcaat
aacctgggcaacttcatcaacagggctggtatgtttgtcagtaagttctttgagagctgt
gtccctgccatggctcttcagcaggaggacaagagactgttggctcaggtgggatgggag
ctgaagcagtacattaacctcatggacagagtcaagatccgtgatgccctgaagtgtatc
ctcaacatctctcgccacggtaaccagtacatccaggtcaacgaaccctggaagaaaatt
aaaggagatgaaacagacaggcagcgatcgggtacagtgacaggtgtgtctgtgaatgtg
gcgtgcctgctgtccgtcatgctccagccctacatgccaacggtcagtcacaccatccgc
cagcagctgaacgctccgccctccgttaccgggaccctgctgcagggcacagggaacttc
gtctgctctctgcccgtcgggcatcacattggcacggtcagcccgttgttccagaaacta
gagtccgaacagattgagtctctgaagaagaggtttggaggacagcagccaaagacgaca
gcccagcctgccacaaccccagcttcagatccggctgctcagactgcagtgaacggcgca
gacgctgagagagccagggagttaacactggctgtggcagaacagggggagaaggtccgg
accctgaagggccagaaggcagagaaaactgtgattggagcagaggtcaccaaactactg
gaactgaagaaacagctgtccctggctgagggaaaggacccagaaccagtgctgacaaaa
ggcaagacgacagcccagcctgccacgaccccagcttcagatccggctgctcagactgca
gtgaacggcgcagacgctgagagagccagggagttaacactggctgtggcagaacagggg
gagaaggtccggaccctgaagggccagaaggcagagaaaactgtgattggagcagaggtc
accaaactactggaactgaagaaacagctgtccctggctgagggaaaggacccagaacca
gtgctgacaaaaggcaaga

DBGET integrated database retrieval system