KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237505Help
Entry
112237505         CDS       T05605                                 

Definition
(RefSeq) myotubularin-related protein 1-like
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112237505
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112237505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112237505
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     112237505
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     112237505
Protein phosphatases and associated proteins [BR:otw01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    112237505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 112237505
NCBI-ProteinID: XP_024261871
Position
Unknown
AA seq 394 aa AA seqDB search
MGHTHTQKHTHTDPVPFPSDSRPISVSTLSHFRLTPVPFLSDSCSQDTPFILDVNLGAIS
RLETISVQSHGENTRGMEIVCKDMRSPRFAYKEDASQPEIVEVLAKHAFPLSNDLPLFAF
LYKEEFPVDGWKVYDPMAEYKRQPPSFYPSLLPTTPTSFHPSPPLSQAKDGGYESESFYP
NVELNFLEIPNIHVMRESLRKLKEVVYPSIDEAHWHSAVDQTHWLEYIRLLLAGAVRIAD
KLESGKTSVMVHCSDGWDRTSQLTSLAMLMLDSHYRTLRGFQVLLEKEWISFGHKFAARV
GHGDENHANSERSPLFIQFIDCVWQMNRQFPAAFEFNELFLITILDHLYSCLFGTFLYDS
EQERVAKEVQTKTVSLWSISTVNQRTSPTVLCGL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggacatacccacacacagaaacacacacacacagaccctgtcccatttccgtctgat
tcccgtcccatttccgtctcaaccctgtcccatttccgtctcacccccgtcccattcctg
tctgattcctgttcccaggatactccgttcatcctggatgtgaacctgggagcgatcagc
cgtctggagaccatcagtgttcagagtcatggagagaacacaaggggcatggagatagtc
tgtaaggacatgcgtagtcccaggtttgcctataaggaggatgccagccaaccagagata
gtggaggttctggccaaacacgccttccccctgtcaaacgacctgcccctgtttgccttc
ctgtataaggaggagtttcctgtggatgggtggaaggtgtatgaccccatggcagagtac
aagagacagcctccttccttctacccctccctccttcctaccacccctacttccttccac
ccctcccctcctctctcccaggctaaggatggtggttatgagagtgagagtttctatccc
aacgtagaactcaacttcctggagatccccaacatccacgtgatgagagagtcactgagg
aaactgaaggaagtggtctaccctagtatagatgaggctcactggcactctgcagtcgac
cagacacactggctagagtacatacggctgctcctggcgggcgccgtgcgtatagctgac
aagctggagtctggtaagacctctgtgatggtccactgtagtgatgggtgggaccggacg
tcccagctcacctctctggccatgctgatgctggacagccactaccgcaccctgagagga
ttccaggtgctgttggagaaggaatggatcagcttcggacacaagtttgctgcgcgtgtg
ggtcatggggatgagaaccatgccaactcggagagatcgccactctttatccagtttata
gactgtgtctggcagatgaacagacagttccctgcagcgtttgagtttaatgagttgttc
ctgataaccattctggaccacctctatagttgtctatttggtacattcctctacgacagc
gaacaggaaagagtagccaaggaagtccagacaaagacagtctctctgtggtccatatca
acagtcaaccagaggacttcaccaaccgttctatgtggactatga

DBGET integrated database retrieval system