KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239701Help
Entry
112239701         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: myotubularin-related protein 4-like
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112239701
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112239701
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112239701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112239701
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     112239701
    3.1.3.64  phosphatidylinositol-3-phosphatase
     112239701
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     112239701
Protein phosphatases and associated proteins [BR:otw01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    112239701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 112239701
NCBI-ProteinID: XP_024263895
Position
Unknown
AA seq 1025 aa AA seqDB search
MEVKRMGFDMQNAWRVSDINLKYKLCSSYPQQLLVPVWITDKELESVGSFRSSNRIPVVV
YRHQRNGAVIARCSQPEISWWGWRNTEDEYLVTSIAKACLMDPGTRITCEALACSQPRGE
GPDSSDSDFDSSLTGCPGPDANTAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEV
MFMGMANIHSIRNSFQSLRAVCSQIPDPGNWLSALESTRWLQHLSVMLKAATLVCSAVER
EGRPVLVHCSDGWDRTPQIVALAKILLDPFYRTLEGFQVLVETEWLDYGHKFGDRCGHQE
DAVDVSEQCPVFLQWLDCVHQLFKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLCNNGRER
EVRNIHNRTCSVWSLLRSGNKNFQNFLFIPGHDMVLQPVCHTRALQLWTAVYLPTSSPCT
SAEDAMELYLSPSVQGDELTSRSLDRLPKTRSMDNTGGLPLKRSGPHPHLRDPNLNKHCQ
EARTAHGPGAYGFLPPSPPAHTRSLHQALSQTTNPPVPPPRLPHQTADSHSRTASVTTRP
ACIPSPPAWKGPLPAAVLNGPITNGLQNAPSASAELPAPEQLVPTFPTAMEDSTKTLTDE
AEVPPTLPPRIRESLGQPKATEWALPETQGEEREGKRTESMSGRNLVPLRECVVAVPTSK
EAASSASTVPPVDNSQAVALRRPVSQNQLRVSEELSLLGSHWDSVQGMVQSACSTAASHS
GLSANLSSGFCRALQPTAYQSRRLAGKLLRTQGMAVPNGGWQYGRREREERVRSSAPAPV
SSSPVKSGSSWLSAVRSSSGYAAIMGPTTTSSPPTFSTCQLLPASPQPHPAYLDDDGLPV
PVDAVQQRLRQMEAGYKQEVEVLRSQVRQLQMRLERKQYSTPPSEPDVDYEDDITCLRSQ
TTVMRRTVVRPREDVSQRQLGQREQKDQRSAFLRATQVTRWVPDHMASHCFNCDCEFWMA
KXRHHCRNCGNVFCKDXCHLKLPIPDQQLYDPVLVCNVAVTXLLEARNREIRSQQLKKPI
ATASS
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaagaggatgggctttgacatgcagaacgcctggagagtgtctgacatcaac
ctcaaatacaagctgtgctccagctatccccagcagctgctggtcccagtgtggatcaca
gacaaggagctggagagtgttggttccttcagatcctccaacagaatccctgtggtcgtc
tataggcaccagaggaacggggcggtgatcgctcgctgcagccaaccagagatcagctgg
tggggctggaggaacacagaggacgagtacctggtaacatccatcgctaaggcctgtctg
atggaccccgggaccaggatcacttgtgaggccctggcctgcagccaaccccgaggggaa
ggcccagacagctctgacagcgactttgactcctctctgacaggatgcccaggccctgat
gccaacactgcgccacaaaagcttcttatcctcgacgctcgttcttacaccgctgcagtg
gccaaccgtgccaagggaggtggctgtgagtgtgaagagtactatcctaactgtgaggtg
atgttcatgggcatggccaacatccactccattaggaacagcttccagtccctccgagcc
gtctgcagccagatccctgacccgggcaactggctgtctgctctggagagcacccgttgg
ctgcagcacctgtccgtcatgctgaaggcagccactctggtgtgctctgcggtggaaagg
gagggacgtcctgtcctggtgcattgttcagacggttgggaccgtacccctcagattgtg
gctctcgccaagatcctgctggacccgttctatcggacgctagagggtttccaggtactg
gtggagacggagtggttggactacggtcataagtttggcgaccgctgtggtcaccaggag
gatgctgttgacgtgagtgagcagtgcccggttttcctccagtggctggactgtgttcat
cagctgttcaaacagttcccctgcctcttcgagttcaacgaagccttcctggtcaagctg
gtgcagcacacgtactcgtgtctgtacgggacgttcctgtgtaacaacgggcgggagaga
gaggtccgcaacatccacaaccgcacctgctccgtctggtctctgctccgctccggcaac
aagaacttccagaacttcctctttatccccggtcatgatatggtgttgcagccggtgtgc
cacacccgggccctgcagctgtggacggcagtctacctacccacctcctccccctgcacc
tctgccgaagacgccatggagctctacctgtcccccagcgtacagggagacgagctcacc
tcacggtccctggacaggcttcctaaaactcgctccatggacaacactggtggtctgcct
ttgaaacggagtggccctcacccgcacctccgcgaccccaacctcaacaagcactgtcag
gaggcccgtactgcccatgggcctggagcctatggcttccttcccccctcgccccctgcg
cacacccgctccctccaccaggccctctcccagaccactaaccccccggttcctccccct
cgactgccacatcagacggctgacagtcactccaggactgcctcggtcactacccgtccc
gcctgcataccatcaccacctgcctggaagggcccgctaccggcagctgttctaaacggg
cctatcaccaacggcctccagaacgccccctccgcttctgcagagctgccggcacccgag
cagctagttcccacgttccctacggccatggaggactccaccaagacgctcacggacgaa
gcagaggtcccaccaacgcttccccctagaatcagagaaagtctaggccagcccaaagcc
acagaatgggccttacccgagacccagggagaggagagagaggggaagaggaccgagagt
atgagtggtagaaacttagtgcctctgagagagtgtgtggtagcggtaccaacatcaaaa
gaagcagcatcctccgcctccacagtgccccctgttgacaacagccaggctgtggcattg
cgacgcccggtctcccagaaccaactgcgtgtcagtgaggagctgtctctgctgggctct
cactgggacagtgtccagggcatggtccagtctgcctgcagcactgctgccagccactct
ggcctctcagccaacctctcgtcaggcttctgtcgtgcccttcagcccacggcctaccag
agccgacgcctggctggcaagctactgcgcacccagggcatggccgtgcctaacgggggt
tggcagtacggccgaagggagagggaagagagggttcgctcctcggctccagccccagtc
agctccagccctgtcaagtcagggtccagctggctctctgcagtcagaagcagctcgggc
tacgctgccatcatgggcccaaccaccaccagctcacccccaaccttttcaacctgccaa
ctcctcccagcctccccccagccccacccggcctacctggatgatgatggtctgccggtg
cctgtggacgccgtgcagcagcgcctcaggcagatggaggcggggtataaacaggaagtg
gaggtgctgagaagccaggtgcgacagctgcagatgaggctggagaggaaacagtacagc
acaccgccctccgagcctgacgtcgactacgaagacgacattacttgtctgcggagtcag
acgacagtgatgaggaggacagtcgtcagaccacgcgaggacgtttctcagaggcagctg
ggacagagggagcagaaggaccagaggtcagcgttcctcagagctacgcaggtcacgagg
tgggtgcctgatcacatggcctctcattgtttcaactgtgactgtgaattctggatggcc
aagnaacgtcatcactgcaggaactgtggcaatgtgttctgtaaagacngctgccacctg
aagctgcccatcccagaccagcagctgtatgaccctgtgttggtgtgtaacgtcgctgtg
actnngctgctggaggctaggaacagagagatccgcagccagcagctcaagaagcccatc
gccacagcctccagctga

DBGET integrated database retrieval system