KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240281Help
Entry
112240281         CDS       T05605                                 

Definition
(RefSeq) tripeptidyl-peptidase 2-like
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8
Motif
Other DBs
NCBI-GeneID: 112240281
NCBI-ProteinID: XP_024264363
Position
Unknown
AA seq 177 aa AA seqDB search
MAAHSTDEPFPFHGLLPKKETGAASYLTRFPEYDGRGVVIAILDTGVDPGAPGMQTTTEG
KPKIVDIIDTTGSGDVTMATVVEPKDGEVTGLSGRTLKIPHAWDNPSGKYHIGIKHGYEL
FPKALRERIQVWSGFVWPSNEDLHVDIHYKSTWTPARPTSHSKIMTINMELDPLLLL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcattctaccgacgagccgttccctttccacgggttgctccctaaaaaagag
accggcgctgcgtcttatctcactaggttccccgagtacgatggacggggtgtcgtcatc
gctatcctcgacactggcgtggacccaggggccccgggcatgcagaccacgacggagggc
aagccgaagatcgttgacatcatcgatacgacaggcagtggagatgtcaccatggcgacg
gtggtggagcctaaagacggagaggtgaccgggctgtccgggaggacgctcaagatccct
catgcctgggataatccatcaggaaagtaccacattgggatcaaacatggatatgagttg
ttccctaaagctctccgagagagaatccaggtatggagtggatttgtgtggccaagtaat
gaggatttgcacgttgatatacactacaaaagtacgtggacacctgctcgtccaacgtct
cattccaagataatgaccattaatatggagttggacccccttttgttgctataa

DBGET integrated database retrieval system