KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240611Help
Entry
112240611         CDS       T05605                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00480  Glutathione metabolism
otw00590  Arachidonic acid metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112240611
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112240611
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     112240611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 112240611
NCBI-ProteinID: XP_024264655
Position
Unknown
AA seq 215 aa AA seqDB search
MEALEVLGGYPTKPSNPRSRMVRVLLSMTVVMGCLLTLHSFLKITKSRKPQDFYSFEVKD
AKGRSVSLERYRGKASLVVNVASHSEHTENNFRSLQELHRELGTSHFNVLAFPCGQFGET
EMGTSRDIEANAKNTHGVTFPIFSKIKIMGSEAEPAFKFITDSVKKIPKWNFWKFLVNPE
GQVVRYWKAEEPVESVRQEATAMVREIILKKRAEL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggaggttttggggggctacccgaccaagccctcgaaccctcgatcacga
atggtcagggttctactgagtatgactgttgttatgggatgtttattaacgctacatagt
tttctcaaaatcactaagtcgcggaagccgcaagatttctactcttttgaggtgaaggac
gccaaagggagaagcgtttctctggagagatacagaggcaaagcgtctctggttgtcaac
gtggcgagccacagcgaacacacagagaataactttcgctctctgcaagagctgcaccgg
gaactggggacgtcccatttcaacgtgctggcttttccctgcggccagttcggggagacc
gagatggggaccagccgggacatcgaggccaacgccaagaacacccatggcgtcaccttc
cctatcttcagtaagatcaaaatcatgggatcggaggcggaaccagcttttaaattcata
acagattctgtaaaaaagattccgaagtggaacttctggaagttcctggtgaaccctgag
ggccaggtggtgaggtactggaaggcagaggagcccgtcgagagtgttcgtcaggaggcc
acggccatggtgcgcgagatcattctgaagaaaagggcagaactctaa

DBGET integrated database retrieval system