KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245376Help
Entry
112245376         CDS       T05605                                 

Definition
(RefSeq) cytosolic 5'-nucleotidase 1A-like isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw00240  Pyrimidine metabolism
otw00760  Nicotinate and nicotinamide metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112245376
   00240 Pyrimidine metabolism
    112245376
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    112245376
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     112245376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase CENP-L
Motif
Other DBs
NCBI-GeneID: 112245376
NCBI-ProteinID: XP_024269192
Position
Unknown
AA seq 373 aa AA seqDB search
MAESKTTDPAATEAGEEKDWTATKAFFDSLKTNQPRPPKPQYAVTIAVSSRSLFNMVAEG
KIYKEDGVEKYVAYQQEHDNEPLMPGVAFPLVEALMNVNAGLRRLYPDSDELFDIVLMTN
NHAQVGVRLINSINHYGSWSTLSAILQCYLTIERFCMTGGESPIGYLKAYMTNLYLSKDG
EQVIEAIEEGIAAATTFASGDVENQLSDTQLKVAFDGDAVLFSESAIIVKQHSLDTFFEH
ETEFENKPRAQGPVKCFLEALGMLQRKFYAKNERMTCPIRTYLVTSRSAASSGVRVLKTL
RSWGLEIDEALFLAGAPKGPLLQKIQPHIFFDDQMFHIEGAKELGTIAAHVPYGIGQKYH
KGIFTEQPAKDTT
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagcaaaactaccgatccagcagccacggaggctggagaggaaaaggactgg
acagcaacaaaagccttttttgacagtttaaaaacaaaccaacctagacctcccaaaccc
cagtatgccgttactatcgccgtctcctctcgctccctgttcaacatggttgcagagggg
aagatctacaaagaagatggggtcgagaagtatgtggcctatcaacaggagcacgacaat
gagccgctcatgccaggggtggcgtttcctctagtggaggctctgatgaatgtgaacgca
gggctgaggcggctctaccccgacagcgacgagttgtttgacatcgtcctgatgacgaat
aaccatgcccaggtcggggtgcgcctcatcaacagcatcaaccactacggttcgtggtcg
acactctcagccatactacagtgctatttaaccattgaaagattctgtatgacgggaggg
gaaagccctattggctacctgaaggcctacatgaccaacctgtacctctcaaaggatgga
gagcaagtcatcgaggccattgaggagggcattgcagcagcgaccacgtttgcgtccgga
gatgtggagaaccagctatccgacacacagctgaaagttgcctttgacggggacgccgtc
ctcttctctgagtcggcgatcatcgtgaaacaacacagcctggacacgttctttgagcac
gagacagagtttgagaacaaacctcgtgcacagggtcccgtaaagtgtttcctggaggcg
ctggggatgctccagaggaagttctatgccaagaacgagcgtatgacctgccccattcgt
acctacctagtaacatcccgcagtgcggccagctcaggggtccgcgtcctcaagacactc
aggagctggggcctggagatagatgaggccctgttcctagccggggcccctaaagggcct
ctcctgcagaagatccagcctcacatcttctttgatgaccagatgttccacattgaaggt
gccaaggagctggggactatcgctgcacacgtgccttatgggattggacagaagtaccac
aaggggatatttactgagcagcctgccaaagacacgacgtag

DBGET integrated database retrieval system