KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245388Help
Entry
112245388         CDS       T05605                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00071  Fatty acid degradation
otw01212  Fatty acid metabolism
otw03320  PPAR signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112245388
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112245388
   03320 PPAR signaling pathway
    112245388
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:otw03029]
    112245388
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     112245388
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112245388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 112245388
NCBI-ProteinID: XP_024269206
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVGFQFTVTSDGIDLHLSREVLKHIYLSGVTSWTKRAIRFKNGILTGVYPASPS
SLLIVVIAIMSTIYAKIDPSLGMIDTIKRTMSVSGYMTVQTQTVLSAILFSTGLWLSLIL
MLRYILKALLSYHAWIFESHGKISFCTKLWLSLVKMFSGRRPLLYSFQTSLPRLPVPSVD
DTITRYLESVRPLLDDEQYNQMEVVANDFKKDQAPKLQKYLILKSWWATNYVSDWWEEYI
YLRGRSPIMVNSNFYSMDLLYVTPTHRQAARAGNVVHAMLQYRRKLERREHAPLRALGVV
PMCSYQMERMFNTTRIPGIETDFVQHLSDRKHLVVYHKGRFFKVWLYYGGRHLWPSELET
QFQRILDDTTEPQPGELKLAALTAGNRVPWARARLKYFSQGVNKASLEAIETSAFFLSLD
DEVHGYDPDKLRSLDLYAKSLLHGKCYDRWFDKSFTLIAYKNGKLGVNAEHSWADAPIIG
HMWEYVLATDCFHLGYTEEGHCKGDINKGLPPPTKLQWDIPLECQEVIEESYMVAKVIAD
DVDFHGCLFDEFGKGLIKKSRTSPDAFIQLALQLAQFRDKGEFCLTYEASMTRMFREGRT
ETVRSCTSESTAFVRAMEDKNTASAQKLDLFRKAADKHQNMYRLAMTGSGIDRHLFCLYI
MSKYLSIDSPFLKQVLSEPWRLSTSQTPQQQLNMVDIKTFPRYVGAGGGFGPVADDGYGV
SYIIIGENLITFHISSKFSSPETDSYRFGQNIRQAMLDICALFDQKDKNEKEM
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcacatcaggcagttggcttccagttcaccgtcacctcagacggcatcgac
ctccacctgagccgcgaggtactcaaacacatctacctgtcgggagtgacgtcatggaca
aagcgcgccataagatttaaaaatgggatattgacaggtgtctaccctgccagcccatcc
agtttgctgatcgttgtgatagccataatgagcaccatatatgccaagatagacccatca
ctgggaatgatagacaccatcaagaggaccatgtctgtcagtggctacatgacagtgcag
acccagacagttctgagtgccatcctgttttccacaggcctgtggctctctctcatcctc
atgctgaggtacattctcaaggcccttctctcctaccatgcctggatctttgagtcccat
ggcaaaattagcttctgcaccaaactctggctgagtctggtgaagatgttctctgggcgc
agacctctcctctatagcttccagacctccctacccagactacctgtgcctagtgtggat
gacaccataaccaggtacctggagtcagtgcgccccctgctggatgatgagcagtacaac
cagatggaggtggtggccaatgacttcaagaaggaccaggcacccaaactccagaaatac
ctcatcctcaaatcctggtgggctactaactatgtgagtgattggtgggaggagtacatc
taccttagaggcaggagtcccatcatggtcaacagtaacttctactccatggatctgctg
tacgtgactcccacacacagacaggcagctcgggcagggaatgttgttcacgctatgctg
cagtaccgccgcaaactagagagaagagaacatgcaccgttgagggctctgggggtggtg
cccatgtgttcttatcagatggagaggatgttcaacaccacacgtatccctggtatagag
acagactttgttcagcacctgagtgaccggaagcacctggtggtgtaccataagggccgc
ttctttaaggtgtggctgtactacggggggcgtcacctctggccctctgagctggagact
cagttccagaggatcctcgacgacaccaccgagccacagcctggggaactcaaactggct
gccctcacagccggcaacagagttccgtgggcgcgggctcgtctgaagtacttcagccag
ggtgtcaacaaagcctctctggaggccatcgagacgtcagctttcttcctcagccttgat
gacgaggtgcatggttatgaccctgacaagctgaggtcattggacctgtatgccaagtcc
ctgctgcacgggaagtgctatgacaggtggtttgacaaatctttcactctgatcgcttat
aagaacggtaaactgggggttaatgcagaacactcgtgggcagacgctcccattatagga
cacatgtgggagtatgtcctagcaacggactgcttccatttgggctacacagaggaggga
cactgcaaaggagacatcaacaagggcctgcctccccccaccaaactacaatgggacatt
ccactggagtgccaggaggtcattgaggagtcctacatggttgccaaggtgatagctgat
gacgtggactttcatggctgtctgtttgatgagtttgggaaaggcctgatcaagaagagt
aggaccagtcctgatgccttcatacagctagcactacagctggcccaattcagggataag
ggggagttctgtctgacgtatgaggcctcaatgacccggatgttccgtgagggtaggaca
gagacggttcgctcctgcacctcagagtccacagccttcgtcagagccatggaggacaag
aacactgcgagtgcccaaaagttggacctcttccggaaggccgcagacaaacaccagaac
atgtaccgtctggccatgacaggctctggcatcgacagacacctcttctgtctctacatc
atgtctaagtacctcagcatcgactcaccattcctcaaacaggtgttgtcagaaccctgg
aggttgtccactagtcagactcctcaacagcagctcaacatggttgacataaagacgttt
cccagatacgtgggcgcggggggggggttcggccctgtggctgatgacggctatggcgtc
tcttacatcattataggagagaacctgatcacattccacatctccagcaagttttccagc
cctgagacggactcgtaccgctttggacagaacattcgacaggccatgctggacatttgt
gcgctattcgaccaaaaagacaagaatgagaaagagatgtga

DBGET integrated database retrieval system