KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248580Help
Entry
112248580         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112248580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112248580
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112248580
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112248580
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112248580
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112248580
   Centrosome duplication proteins
    Regulators of centriole replication
     112248580
  Sister chromatid separation proteins
   Polo kinases
    112248580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112248580
NCBI-ProteinID: XP_024273492
Position
4
AA seq 658 aa AA seqDB search
MELLRNIAEQPTNINRMCEPKLQGSCELRRKRTEDHGLAPAEMARIVTDHVSGKCYCRGK
VLGKGGFAKCYEMTDLSTSKVYAAKIIPHTRVSKPHQREKIDREIELHRVLHHKHIVHFY
HHFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDL
KLGNFFVSESMELKVGDFGLAAKLESAGNRKKTICGTPNYLSPEVLNKQGHGCESDVWAL
GCVMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLSPQAKQLISSLLAKTPEDRPHLD
HILRHEFFTQGFVPERLPASCCHSAPEFHVSSPAKSFFKKAAAALFGGKRDKVKYYETLN
KLTKEEEEIYKLRHDLKKTVISQQTKQITEDGRPLSPSAGRPVAPSTEGLPPTTRDPIRL
IVRGSLGSCSSSSECLEDSTTGSVAETVASVLRGCLENMPKAGDLPKGIECSNLQWVTKW
VDYSNKYGFGYQLSDHIVGVLFNNGTHMSLLADKKTVHYYAELGQCSVFSTSDVPEHFVG
QVTVLKYFAHYMEENLMDGGDLVSQADTHMPRLYLLQWLKSDRALMMLFNDGTFQVNFYH
DHTKIILCTQREEYLLTYINEERVSSTFRLSSLLTSGCPADLRQRMEYSLNMLLQRFD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttaggaatatcgctgaacagccgacgaatatcaacaggatgtgcgagccc
aaactgcaggggtcctgtgaactgcggagaaagaggacggaggatcacggtctggcacct
gcggagatggcgaggattgtcacggatcacgtcagcgggaaatgttactgccgtgggaaa
gttctgggaaagggaggtttcgccaagtgctatgagatgaccgacctgtccacgagtaaa
gtttacgcagcgaaaattattccccacacgcgcgtatccaaaccgcaccaacgggaaaag
attgacagggaaatcgagctacatagagttctccaccataaacacatcgtgcacttttac
catcatttcgaggacaaagataacatctacattctcctggaatactgcagtagaagatct
ttggcacacatcctgaaggcacgcaaagtgctcactgagcctgaagtgcgatactacctc
cgtcagatcgtctcagggctgaagtacctacatgagcaagagatcctgcacagagacctc
aaactgggtaacttctttgtgagtgagtcgatggagctgaaggtgggagactttgggctg
gctgccaagttggagtctgctgggaacaggaagaagaccatctgtgggacgcccaactac
ctgtcccctgaggtgctcaacaagcagggccatggctgtgagtcggacgtctgggccctg
ggctgtgtcatgtataccatgctcctgggcagacccccgtttgagaccaccaatctgaag
gagacgtacagatgtattcgggaggcgcgttactccctgccctcctccctgtcgccccag
gccaaacagctcatctccagcctcctggccaagactccagaggacagacctcacctggac
cacatactgcgccatgaattcttcacacagggtttcgtgccagagcgtctccctgctagt
tgttgccactctgctccagaattccacgtctccagccctgccaagagcttcttcaagaag
gcagcggctgccctcttcggcgggaaaagagacaaggtcaaatactacgagactctgaat
aaactcaccaaagaggaagaggagatctacaagcttcgacatgacctgaagaagacagtc
atcagccagcagaccaaacagattactgaggacggtaggccactgtcaccatctgctggg
aggccggtcgccccgtcaaccgagggcctgcccccgacgacacgagaccccatacggctt
attgtcaggggcagtctgggtagctgcagcagcagtagtgaatgtcttgaggacagcacc
accggcagtgtggctgagacagttgccagcgttctcagaggatgcctggaaaacatgccc
aaagcgggtgacctccctaaagggatagagtgcagtaacctgcagtgggtcactaagtgg
gtggactactccaacaagtatggctttggctaccagctctccgaccacatagtgggagtt
ttgttcaacaacgggacacacatgagcctcctcgcagacaagaagactgtccactactat
gctgagttgggtcagtgctctgtattctccacctctgacgtccctgagcactttgtaggt
caggtgaccgtcctcaagtactttgcccactacatggaagagaacctgatggatggtgga
gacctggtgagccaggcagacacacacatgcccagactctacctgctgcagtggctcaag
tctgaccgtgccctcatgatgctcttcaacgacggcacatttcaggtcaacttctaccat
gaccacactaagatcatcctgtgcacccagagggaggagtacttgctgacctacatcaac
gaggagcgtgtgtcctccaccttcagactgagctccctgctcacctccggctgccccgca
gacctgcgccaacgcatggagtactcactcaacatgctgctgcagcgcttcgactga

DBGET integrated database retrieval system