KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251007Help
Entry
112251007         CDS       T05605                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03040  Spliceosome
otw04010  MAPK signaling pathway
otw04141  Protein processing in endoplasmic reticulum
otw04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112251007
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112251007
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251007
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112251007
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112251007
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:otw03041]
    112251007
   03009 Ribosome biogenesis [BR:otw03009]
    112251007
   03110 Chaperones and folding catalysts [BR:otw03110]
    112251007
   04131 Membrane trafficking [BR:otw04131]
    112251007
   03051 Proteasome [BR:otw03051]
    112251007
   03029 Mitochondrial biogenesis [BR:otw03029]
    112251007
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112251007
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112251007
Spliceosome [BR:otw03041]
 Complex B
  Other components
   Prp19 complex
    112251007
 Complex C
   Prp19-CDC5 complex
    112251007
Ribosome biogenesis [BR:otw03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112251007
Chaperones and folding catalysts [BR:otw03110]
 Heat shock proteins
  HSP70 / DNAK
   112251007
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112251007
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112251007
Proteasome [BR:otw03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112251007
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112251007
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112251007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 112251007
NCBI-ProteinID: XP_024277377
Position
5
AA seq 644 aa AA seqDB search
MSSAKGVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRKFDDQIVKSDMKLWPFKVISDGGKPRVQVEYKGETKAFYPEE
ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTS
AAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLV
NHFVEEFKRKNKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSLFEGMDFYTSIT
RARFEELNSELFRGTLDPVEKALKDAKMDKAQVHEIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSKNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TIPTKQTQIFSTYADNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGIPQVEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQDADKYKAEDDAQREKIAA
KNGLESYTFNMKTSVEDPNLAGKINEDDKKKVVEKCNQTISWLENNQMAEKEEFEYQQKE
LERVCNPIVSKLYQGAGGASPMGSCGSQAGGGASSQGPTIEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagcaaagggagtatccattggcattgacctgggcaccacctactcctgtgtg
ggggtgttccagcatggcaaggtggagatcatcgccaacgaccagggaaacagaacaacg
cccagctacgtggccttcaccgacacagagagactcattggagacgcagcaaagaaccag
gtggccatgaaccccactaacactgtgttcgacgccaaacgcctgattggcaggaagttc
gacgaccagattgttaagtcagacatgaagctgtggcccttcaaggtgatcagcgacggt
ggaaagcccagagtccaggtggagtacaagggagagaccaaggccttctaccccgaagag
atctcctcaatggtcctcgtcaagatgaaggagattgctgaggcctacctgggccagaag
gtgtccaatgcagtcatcacagtcccagcctacttcaacgactcccagaggcaggctact
aaagacgctggggtgatctctggtctaaacgtcctgaggatcatcaatgagcccacgtcg
gcggctatcgcctacggcctggacaaaggcaagagaggggagcgcaatgttctcatcttt
gatctcggcggaggcacctttgacgtctccatcctgaccatcgaggatgggatattcgag
gtgaaggccacagctggggacacacacctgggaggggaggattttgacaaccgcctggtc
aaccactttgtggaggagttcaagaggaagaacaagaaggacatcagccagaacaagagg
gcagtgagaaggctgaggacagcctgtgagagggccaagagaactctctcctccagttcc
caggccagcatcgagatcgactccctcttcgaaggcatggacttctacacctccatcacc
agggctcggtttgaagaactcaactcggagctcttcaggggaaccctggacccggtcgag
aaggccctgaaagacgctaagatggacaaggctcaggtccacgagatagtcctggtcggt
ggctccactcgaatccctaagattcagaagctcctgcaggacttctttaatggaagggaa
ctcaacaagagcatcaacccagatgaagcggtggcttacggtgctgccgtccaggcggcc
atcttgatgggcgacacctctaagaatgtccaggaccttctcctccttgacgtggctcct
ctgtccctgggcatcgagacggctggaggggtcatgaccgccctgatcaaacgtaacacc
accatccccaccaagcagacccagatcttctccacctatgctgacaaccagccaggtgtg
ctcatccaggtgtacgagggagagagagccatgaccaaggacaataatctgctgggaaag
tttgagctcacgggtatccctcccgctccgagaggaattccacaggtcgaggtgaccttt
gacatcgacgctaacggcatcctgaacgtgtcggcggtggataaaagtacaggcaaggag
aacaagatcaccatcaccaacgacaaggggcgactcagtaaagaagacatagagaggatg
gtgcaggatgcagacaaatacaaagctgaggacgatgcccagagggagaagatagcagcc
aagaacgggttggagtcctacacgttcaacatgaagactagtgtagaagatccaaacctg
gcagggaagatcaacgaggatgacaagaagaaggttgttgagaagtgcaaccaaactatc
tcctggttggagaacaaccagatggctgagaaagaggagtttgaataccaacagaaggag
ctggagagagtgtgtaacccaatcgtatccaagctctaccagggggcgggaggggctagt
ccaatggggagttgtggcagccaggctgggggcggtgctagctcccagggccctaccatt
gaagaggtagactaa

DBGET integrated database retrieval system