KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251074Help
Entry
112251074         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251074
   04068 FoxO signaling pathway
    112251074
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112251074
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112251074
   04217 Necroptosis
    112251074
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112251074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112251074
   04052 Cytokines and growth factors [BR:otw04052]
    112251074
   04090 CD molecules [BR:otw04090]
    112251074
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112251074
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112251074
CD molecules [BR:otw04090]
 Proteins
  112251074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Sarcoglycan_1
Motif
Other DBs
NCBI-GeneID: 112251074
NCBI-ProteinID: XP_024277520
Position
5
AA seq 257 aa AA seqDB search
MFLVDYSGGSQPSVQPPGLVPCWSFPPAQERVREQGRARGCRGVGSWSLVVALLFLLLLV
FGALGLGAYQIHKLQTQLDGIQQVNIESQGCAPEKLVGDLPESDPDTGKKASRPAAHVIG
RIEKDVSQNTLRWEPKAGRAFTEGGVVYRDGGLQVNETGLYHIYSRVQFEANHCTPTDAL
VHSVFVRRPWSSKPLTLIEAHREGYCSSGSNGRVWTSGSYLGSTLQLEKQDWVYVNVSHP
AMLSHTHHANFFGLHKI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagtggactacagtggaggttcacagccgtcggtccaacctccaggcctggta
ccttgctggtccttccctcctgcccaggagagggtaagggagcagggcagggccagaggc
tgcaggggggttggctcctggagcctggttgtggctttgctgtttctgctactgctggtg
tttggggctctggggctgggagcctaccagatacacaagctacagactcaactggatggg
atacaacaggttaacattgagagccaaggttgtgcgcctgagaagctagtgggtgacctt
ccagagtctgatccagacacagggaagaaggccagcagacctgcagcacacgtcataggc
cggatcgagaaggatgtttcccagaataccttgcgttgggagcccaaggcagggcgggcc
ttcactgagggaggcgtggtctatcgggatggtggtctgcaggtcaacgagactgggctc
taccacatctactcccgggtgcaatttgaggccaatcactgcacccctacagatgccttg
gttcactctgtgtttgtgaggaggccctggagctccaagcctctcaccttgatagaggcg
cacagggagggctactgcagctcgggctctaatgggcgtgtctggacctctgggagttac
ctgggctccacattgcagctggagaagcaggactgggtctatgtgaacgtctcccaccca
gccatgctcagccacactcatcatgccaacttctttggactccacaagatctag

DBGET integrated database retrieval system