KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252924Help
Entry
112252924         CDS       T05605                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1A-like isoform X1
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112252924
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112252924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252924
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112252924
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112252924
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112252924
CD molecules [BR:otw04090]
 Proteins
  112252924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 112252924
NCBI-ProteinID: XP_024280397
Position
6
AA seq 532 aa AA seqDB search
MTVLPFFITAVGVWILLVIRAEGIQTGQNPDHMLHGTGHKHESRKPGDDTTVAPEDAARF
LSCYCSGYCPEDHKNNTCETNGQCFAIIEEDENGEAILTSGCMKYEGSHFQCKDSPRAQT
RRTIECCGTDFCNRDLQPTLPPPMDTGSYFGSAHWLAFLISMTVCCCTLICITVVCYYRY
KWQTERQQYHRDLEQDEAFIPVGESLKDLINQCQSSGSGSGLPLLVQRTIAKQIQMVRQI
GKGRYGEVWLGRWRGEKVAVKVFFTREEASWFRETEIYQTVLMRHENILGFIAADIKGTG
AFTQLFLITDYHENGSLYDYLRFTTLDTQSLLRLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILMKKNGTCCIADLGLAVKFNSDTNEVDVPLSTRVGTRRYMAPEVLAETLNKN
HFQAYIMADIYSYGLVIWEIARRCITGGIVEDHQLPYYEMVPSDPSFEDMLEVVCVKGLR
PTVSNRWNGDECLRTMLKLMSECWAHNPASRLTILRVKKTLAKMVESQDIKM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcttccctttttcatcactgcggtgggagtctggatcctactggtgatcaga
gctgaaggtattcaaactggtcagaatccagaccacatgctccacggcaccgggcacaag
catgagtccaggaagcccggggacgacaccacggtggccccagaggacgccgcccgcttt
ctgagctgctactgctcgggttactgtccagaggaccacaaaaataacacctgcgagacg
aatggccaatgttttgccatcatagaggaggatgagaacggagaagctattctgacctct
ggctgcatgaagtatgaaggctcacattttcaatgcaaggattcgcccagggctcagaca
aggcgaacgatcgaatgctgcgggacggacttctgtaatcgggacctgcagcccacatta
cctcccccaatggacactggttcctactttggcagtgcccactggctggcgttccttata
tcaatgaccgtatgctgctgcactctcatctgcatcacagtagtctgttactacaggtac
aagtggcagacggagcggcagcagtaccaccgggacctggagcaggacgaggccttcatc
cctgtgggagagtctctcaaagacctcatcaaccagtgccagtcttctggcagtggctca
gggctccccctgctggtgcagcgcaccattgccaagcagatccagatggtgcgtcagatc
ggcaaggggcgctacggcgaggtgtggctgggccgctggcggggagagaaggtggccgtc
aaggtgttcttcacccgggaggaggccagctggttcagagagaccgagatctaccagaca
gtcctcatgaggcacgagaacatactgggtttcatagcggcagacatcaagggtaccggg
gccttcacccagctcttcctcatcacagactaccacgagaacggctccctgtacgactac
ctgaggttcaccacgctggacacccagagcctgctgcgactggcctactccgccgcctgc
ggcctgtgtcacctccacacggagatctacggcacccagggcaagccggccatcgcccac
cgagacctgaagagcaagaacatcctgatgaagaagaatggcacctgctgcatcgctgac
ctgggcctggccgtcaagttcaacagtgataccaacgaggtagacgtccctctgagtaca
cgggtggggacccggaggtacatggccccagaggtgctggccgagaccctgaacaagaac
cacttccaggcctacatcatggctgatatatatagctacggcctcgtcatctgggagatt
gcccgccgctgtataacaggaggtatagtggaggatcatcagctgccatactatgagatg
gtgccgtcagacccgtccttcgaggacatgctggaggtggtgtgtgtgaaagggctgcgg
cccaccgtgtccaacaggtggaatggtgacgagtgtctgagaaccatgctgaagctgatg
tctgagtgctgggcccacaaccccgcctcacgcctcaccatcttacgagtcaagaagacc
ctggccaaaatggtggaatcacaggacatcaaaatgtga

DBGET integrated database retrieval system