KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254157Help
Entry
112254157         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04933  AGE-RAGE signaling pathway in diabetic complications
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254157
   04370 VEGF signaling pathway
    112254157
   04068 FoxO signaling pathway
    112254157
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112254157
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112254157
   04621 NOD-like receptor signaling pathway
    112254157
   04622 RIG-I-like receptor signaling pathway
    112254157
   04625 C-type lectin receptor signaling pathway
    112254157
  09152 Endocrine system
   04912 GnRH signaling pathway
    112254157
   04914 Progesterone-mediated oocyte maturation
    112254157
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112254157
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112254157
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112254157
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112254157
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112254157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like Aft1_OSA
Motif
Other DBs
NCBI-GeneID: 112254157
NCBI-ProteinID: XP_024282206
Position
7
AA seq 361 aa AA seqDB search
MFHKERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPF
QSVIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDQRITA
SEALAHSYFSQYHDPGDEPESEPYDQSFESRELEIEEWKRLTYEEVCSFEPLPFDGDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacaaggagagacccactttctaccgacaggagctcaacaagacgatatgggag
gtcccggagcggtaccagaccctgtccccggtcggctcgggagcctacgggtccgtctgc
tcgtcgtatgacgtgaagtcggggctgaagatagcggtgaagaagctgtcgaggccgttc
cagtccgtcattcacgctaagaggacctacagagaactacgactcctcaaacacatgaaa
cacgagaacgtgatcggcctgttggatgtgtttacgcccgctaccagcctagaggagttc
aacgatgtgtacctggtgacccacctgatgggggcggacctcaacaatatcgtcaagtgt
cagaaactgacggacgaccacgttcagttcctcatataccagatcctccggggtctcaag
tatatccattcagcagacatcatccacagagatctgaagcccagtaacttggcagtgaat
gaggactgtgagctcaagatcctggactttggtttggcgagacacactgatgatgagatg
acgggttacgtagcaaccaggtggtaccgcgccccagagatcatgcttaactggatgcac
tacaacatgacagttgacatctggtcggtgggctgcataatggcggagctgctaaccgga
aggacgttattccccggcaccgaccatattaaccagctgcagcagatcatgaggctgaca
ggtacacccccggcctctgtcattagccggatgcccagccacgaggccagaaactacatt
aattcccttccccagatgcccaagaggaactttgctgatgtgttcattggcgctaaccca
ctagcggtggatctgttagagaagatgttggttctggacactgatcagcggatcacagcg
tcagaggccctggcccactcctacttctcccagtaccacgacccaggcgatgaaccagag
tctgagccatacgaccagagctttgagagccgtgagctggagatagaggagtggaaaagg
ttgacctatgaggaggtttgcagcttcgagcccctgccattcgacggagacgagatggag
tcctga

DBGET integrated database retrieval system