KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255365
Entry
112255365         CDS       T05605                                 

Definition
(RefSeq) acid-sensing ion channel 1B-like
  KO
K04829  acid-sensing ion channel 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112255365
Ion channels [BR:otw04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   112255365
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 112255365
NCBI-ProteinID: XP_024284126
Position
7
AA seq 560 aa
MPVRIMCSISFSADDEPRGLGKDGFDDRYRKGIKSGDGSGRGDYREDGCDELDVYDEDED
DASQLDSLSVFFDGCSLHGANHIFAEDKKFSVRQGLWAIVFLLALSAFLLQVFDRVVYYL
SYDHVTMLDERNAPNLTFPAVTFCNYNYFRRSQISYSDLLFMGQLLGYEDNMAPGIPLAP
EPDRQGSRFSLDEFHNRTRHRIEDMLLECNFRGKECGPEAFREIFTRYGKCYTFNSGQDN
RPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGF
GVAPGFQTFVSCQEQRLTYLPPPWGDCKSTPIDSDFFSSYSLTACRIDCETRYLVENCNC
RMVHMPGDAPYCTPEQYKECADPALGKLLVERDNDYCVCETPCNMTRFGKEMSFVKIPSK
ASAKYLAKKYNKTEQYIADNILVLDIFFEALNYETIEQTKAYEFAGLLGDIGGQMGLFIG
ASILTILELFDYLYEVIKYKLCRCSNKKHKRSNSNDRGAALSLEDVKRHTPCENLRTPGS
YPANMLPHHPAQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcccgtccgcatcatgtgcagcatctccttctcggccgacgacgagcccagaggactg
ggaaaagacggcttcgacgaccgctaccgcaaggggatcaaatccggtgatggcagcggt
cggggggattaccgggaggacgggtgtgatgaattggacgtgtatgacgaagatgaagat
gacgccagccagttagacagcctctcagtgttcttcgacggctgctcgctccacggcgcc
aaccacatcttcgcagaagacaagaagttcagcgtgcgtcagggcctctgggccatcgtc
ttcctgttagctctctctgctttcctcctccaggtgttcgaccgtgtcgtctactacctg
tcctacgatcacgtcacaatgctggacgagagaaatgccccaaacttgaccttcccggcc
gtcaccttctgcaactacaactacttccgccgctcccagatcagttatagtgacctgctg
ttcatgggccagctgctggggtatgaagacaacatggcccctgggatccccctggccccc
gagcccgaccgccagggatccaggttcagcctcgatgagttccacaaccgtaccagacac
cgtatagaagatatgctgctggagtgcaacttcagagggaaagagtgtggcccggaggcc
ttcagagagatcttcacccgttatgggaaatgctacacgttcaactctggtcaagataac
cggccgctgctggtgaccatgaagggagggatgggtaacggcctggagctgatgttggat
atacaacaagacgaatacctgcccgtctggggggaaacagatgagacatcatttgaggca
ggcatcaaggtccagatccacactcaggacgagccacccttcattgaccagctgggcttt
ggagtggccccaggcttccagaccttcgtatcttgtcaggaacaacggctgacgtacctg
cctcctccgtggggcgactgcaagtccactcccatagactctgacttcttcagctcctac
agcctcacggcctgccgtatcgactgtgagacgcgctacctggtggagaactgtaactgc
cgcatggtgcacatgcctggagatgccccatactgtaccccagagcagtacaaggagtgt
gccgaccctgccttgggtaaacttctggtggagagggataatgactactgtgtgtgtgag
acaccctgcaacatgacgcgctttggaaaggagatgtccttcgtcaagattcccagtaag
gcctcagccaagtacctggccaagaagtacaacaagactgagcaatacattgctgataac
atcctggttctggatatcttctttgaggccctgaactacgagaccatcgagcagacgaaa
gcttacgagttcgctgggttgctgggtgatattggtggtcagatgggtctgttcattgga
gccagtatcctcaccatcttggagctctttgactacctatatgaggtgatcaagtacaag
ctgtgtcggtgctcaaataagaaacacaaacgcagcaacagcaacgaccggggagcagct
ctgagtctggaggacgtcaagcgccatacgccctgtgagaacctgcgtacgccgggttcg
tatcctgccaacatgcttcctcaccatccagcacagggcaacttcgaagacttcacatgc
tga

DBGET integrated database retrieval system