KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255964Help
Entry
112255964         CDS       T05605                                 

Gene name
phf6
Definition
(RefSeq) PHD finger protein 6
  KO
K23310  PHD finger protein 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112255964 (phf6)
   03009 Ribosome biogenesis [BR:otw03009]
    112255964 (phf6)
   03036 Chromosome and associated proteins [BR:otw03036]
    112255964 (phf6)
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    112255964 (phf6)
Ribosome biogenesis [BR:otw03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   112255964 (phf6)
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    112255964 (phf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 112255964
NCBI-ProteinID: XP_024284597
Position
8
AA seq 367 aa AA seqDB search
MSAQRKGAAAKLRKCAFCRTNRDKECGQLLVSDNQKVAAHHKCMLFSSALVTSHSDCNEN
IGGFSVQDVRKEIKRGNKLMCWSCHRPGATVGCDVKTCRRTYHYYCAVWDKAQVKENPSQ
GSYLVYCRKHRDASQDASEDEQEQGGVANDSDSSPPRSRGRGRLEKERIKVGSRGQSEDT
RSTSSQGVDDESSSHRDRSPLRGSGDGGQRCGFCHSGEEENEMRGVLHADNAKKVAAHYK
CMLFSSGTVQLTTSSRAEFGNFDIKTVIQEIKRGKRMKCTLCTQLGATIGCEIKACVKTY
HYHCGLQDKAKYIENMARGIYKLYCKNHSGNEERDEEDEERESRNRERAAIDHGGTLPLP
PPQINGN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacagaggaagggagcggcagccaagctgcgaaaatgtgccttctgcaggacg
aaccgggacaaggagtgtggacagctgctagtgtcagacaaccagaaggtggcagcccac
cataagtgcatgcttttctcctccgccctggttacatctcactcagactgcaacgagaac
atcggggggttttctgtccaggacgtgagaaaggagatcaagagggggaataaacttatg
tgctggtcctgccatcggcctggggccactgttggctgtgatgtgaagacatgccggcgg
acgtatcactactactgcgcagtatgggacaaggcccaggtcaaagagaatccctcacaa
gggagctaccttgtgtattgtcgcaaacaccgggatgcctcccaggatgccagtgaagat
gaacaggaacaaggaggtgttgccaatgactcagactcctcccctccacggagtaggggg
cgtgggagattagagaaagagcgaatcaaagttggatcccgtggacaatcagaggacaca
cgctcgacctcctctcaaggtgtagatgatgagagctcctcgcatagggacaggtcccct
ctgaggggctctggggatggtggccagcgctgtggattctgccactccggagaggaggag
aacgagatgcggggcgtgttacatgcagataatgcaaaaaaggttgctgcacattacaag
tgcatgctgttctcatcgggaaccgtccaactcactacctcctcacgggctgaatttggg
aactttgacatcaaaacggtcattcaggaaatcaagagggggaagagaatgaaatgtacc
ctgtgtacccagttgggagccactattggctgtgagatcaaagcctgtgtgaagacctat
cattatcactgtggcctgcaggacaaggccaagtacatagagaacatggctcgtggcatc
tacaagctgtactgtaagaatcacagtgggaatgaggagcgggatgaggaggatgaggag
agggagagtcgcaacagagagcgggcggccattgatcacgggggaacactgcctctgcct
ccgccacaaatcaatggcaactag

DBGET integrated database retrieval system