KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256060Help
Entry
112256060         CDS       T05605                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    112256060
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112256060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112256060
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    112256060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 112256060
NCBI-ProteinID: XP_024284781
Position
8
AA seq 428 aa AA seqDB search
MNFLNKMGLCDPTSNTTNSSYDHGSFGIDGYMNLSSGGPMPVMEEVNISNSESNSMPKSI
ALICFLSLVMLMSVLGNLLVMTAVCKDRQLRKIKTNYFIVSLAFADLMVSVLVMPFGAIE
LIHQNWIYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRKKMTSLRVAL
MLGGCWVIPTFISFLPIMQGWNSIGIDHLIEERKFSGDAVNATACVFMVNKPYALTCSVV
AFYIPLGLMVLAYQRIYVTAREHARQISMLQRAGAASADSADHQRNHRMRTETKAAKTLC
IIMGCFCLCWAPFFITNVVDPFINYTVPGQLWAACLWLGYINSMLNPILYAFLNKSFRRA
FLIILCCGRKRYSARRPSILGPGPPCSATQINGSTHVLKYAALHNGNHIEQEKQSLQRED
TESQESCF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcttgaacaaaatgggattatgtgacccaaccagtaatacaaccaatagctca
tatgaccatgggagttttggcattgatgggtacatgaatctaagttctgggggcccgatg
cctgtgatggaggaagtaaatatcagcaacagtgagagcaacagcatgccgaagagcatt
gctctcatctgcttcctgtccctggtgatgctcatgagtgtcctggggaacctcctggtc
atgacggctgtctgcaaggaccgccagctcagaaaaatcaagaccaattacttcatagta
tcgctggcctttgcagacctgatggtgtcggtgctggtgatgccgtttggtgccatcgag
ctgatccaccagaactggatttatggagaaacgttctgcctggtccgaacatctctagat
gttctgttgacaacagcctccatattacacctgtgttgcatagccttggacaggtactat
gccatctgctgccagccgctggtctacaggaagaagatgacatcactgagagtggctcta
atgttaggaggatgctgggtaatccccacctttatatcctttctacccattatgcaagga
tggaacagtattggaatagaccatttgatagaggagcggaagttcagcggtgacgcagtc
aacgcgacggcgtgtgtcttcatggtcaacaagccctacgctctgacgtgttccgtggtg
gccttctacatcccactggggttgatggtgctggcctaccagcgcatctatgtgactgca
cgggagcacgcacgccaaatcagtatgctgcaacgggcgggggccgcctcggcagacagc
gccgaccaccagcgcaaccaccgcatgcgtacagagaccaaggcggccaagactctgtgc
atcatcatgggctgtttctgcctgtgctgggcccctttttttatcaccaacgtggtggac
ccctttataaactacacagtgccaggccagctgtgggcagcatgcctgtggctgggctac
attaactccatgcttaatcccattctctatgccttcctgaacaagtccttccgccgtgcc
ttcctcatcatcctctgctgtgggagaaagcgttacagcgccaggcggccatccatactg
gggccggggcccccctgctcggccacacagatcaacggctccacccatgtgctcaagtat
gctgccctgcataatggaaaccacattgaacaggaaaagcagtcattgcaaagagaggac
acagagtcacaggagtcctgcttctga

DBGET integrated database retrieval system