KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256367
Entry
112256367         CDS       T05605                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112256367 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112256367 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 112256367
NCBI-ProteinID: XP_024285336
Position
8
AA seq 78 aa
MNVKILTLVIVLLVSLLCSASAGPIMAATEHGTALEEAGAVRRLVQQNPGRGGQSHRPAG
WKRRRPRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatcatggccgccacggagcatggcacagcactagaagaggcgggcgcc
gtgagaaggctggtccagcagaaccccggcaggggtggccagagccacagaccggccggc
tggaagaggagacgcccacggccccgtctctcccacaaggggcccatgccattctag

DBGET integrated database retrieval system