KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258598Help
Entry
112258598         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase 12-like
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112258598
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112258598
    2.7.11.23  [RNA-polymerase]-subunit kinase
     112258598
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112258598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112258598
NCBI-ProteinID: XP_024288843
Position
9
AA seq 1371 aa AA seqDB search
MPGSDRHHGTKRKPESNSSIALPPQTTSGNSGPHQPLVLPHTSAGNMTSKDGNLQSKSSV
PSSSKRKRHKSAKHGRESEVAQGPGFSALTSTAPPSVSAVKPLVEYDDISSDSDTFSDPP
AERGSGDRLEPVPDYSKGDGGGAVGRDGREHKHRHSRKKSKDPNKVRDSGEGGQTTKKKS
SKDRERGSSGKVKEKVASLSSVASLSSGSRRQGQLEADLGPKRGELPPSSQAQTAASVGS
TTSSSSSSRSKEGGRSGKSRKDKPQKTEGREGREGRGDATASQSTSASQKVRTERSQRKS
SKSHKSSPRGKGQPSSSRGSPRRKVTAPTQSPSPPRRGGNGSPMVGGYSQEVDSYHHQRR
RPAPQSPSPYREMSRRSRQRSDSPYASRQRSSSYERDDSPYSRRRSISPYGNRRSSSASP
VSRRSVRSRSRSPPFSSSRRSSSRSRNKKHSSSAGGGGSHSSRPTSRSPPSSRLPLNSSL
GAELSRRKKERQAAVAAARPPSPPPSSRKTKGSTSRPPKAEPERVPERDSVQATDLQPPP
IAPQPQDTLVGEEHGSASPPSIFSSPAPPLPPGQTTPLPPPPLPSTPVAQLQPPTPQGQT
ESSLAPSTALSSSSLSSPQSKSPAPMPTRSPARLTPIHKTSTLPPLPLPPMLVGDCQDSP
KKSTPPQRSSRKEKEVRNRPSLIDLPLPPTLAGGDPSPPQSPVYRAPPPPQSALKKRPKF
CCPRYGERKQTQSDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEK
EGFPITAIREIKILRQLNHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLL
ESGLCQFSQEHVRSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLY
NSEESRPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILGELFTKKPIFQANQELLQ
LELISRLCGSPCPAAWPDVIKLPYFNTMKPKKQYRRRLREEFAFLPAQALDLLDRMLTLD
PARRCTAEQALNSDFLCNVEPSKMSPPNLPHWQDCHELWSKKRRRQRQSGLPEDVPVPKV
PRKDPSGASSGENSRPQASPAGAPPPPPGRPPSSAISANELAGLGAAAEQLNQTELAVLL
NLLQRQTDLSLPQMAQLLNVSSNPESQQQLETLSQSLSALTEASHHRGASEDQGPARSQP
PEPPPEPQEPSPHHSEPPLSQDDQTNLLALLLGQLIKPQAGGAEQGDESNGVQSEEAVTR
GSSASTADRKDCAVTKRKQQIGTNQVPPSSERRPPSPPGPPPSALLPPGQQQPSSEPQPG
PGQDISPAVAAALLQLISQQDPEAGAPQRSRDHSPRRGHPCPGTATPCLDD
NT seq 4116 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtcggatagacaccatgggaccaagaggaagccggaatccaacagtagcatt
gccctgccgccccaaacaacgagtggtaacagcgggccacaccagcccctggtcctgcct
catacctctgcgggcaacatgacgagcaaggacggtaacctccagtcaaagtcgtcagtg
ccatcttcttcaaagcgcaaacggcataaatcagccaaacatggacgtgagtccgaggtg
gctcagggccctggtttttctgccctcacctccacagcgcctccttccgttagcgccgtg
aagccgctggtagaatatgacgacataagttccgattcggatactttttcagacccgcct
gctgaaagagggtctggggatcggttagaacctgtcccagattatagtaaaggggatggg
ggcggggctgttggtagagatggtcgggaacataagcaccgacactctcgcaaaaagtcg
aaggatcccaacaaagttagagactctggggaagggggtcagactaccaagaaaaaaagc
agcaaagaccgtgagagagggagctctgggaaagtcaaggagaaggtggcctccctgtcc
tctgtagcatccctgtcctccgggtcacgacgtcagggtcagctggaggctgacttgggg
ccaaagcgcggagagttgcccccttcctcccaggcccaaactgcagccagtgtgggaagc
accacatcctcctcctcgtcatctcgcagcaaggagggtggccgctccgggaagtctcgc
aaggataagccacagaagacagagggacgggaggggcgtgagggtcggggggatgcaacc
gccagccagagcacctctgcctctcagaaggtccggacggagaggagccaacgcaagtcc
tcaaagagccacaagtccagccctaggggcaaggggcagccttcctcgagcagggggagc
cctcgccggaaggtaacagcccctacacagtcccccagccccccaaggagagggggtaat
ggaagccccatggtcggtggttacagccaggaggtggacagctaccaccaccagagacgc
aggccagccccacagagccccagcccctacagggagatgtccaggcggagcaggcagagg
tcggacagcccctacgccagcaggcagaggtcttccagctatgagcgagacgacagcccc
tactccaggagacgctccatcagtccctatggtaatcgcaggtcctccagcgctagccct
gtgtcccggcgctcagttcgctctcggagtcgttcgccgcctttctcctcttcccgtcgc
tcctcctctcgctctcgcaacaagaagcattcgtcctctgccggggggggcgggtctcac
agcagccggcccaccagccgctccccaccctcttcccgcctgccacttaactccagcctg
ggggcggagcttagccggaggaagaaggagcgccaggctgcggtggctgcagctcgtccc
ccgtcccctccaccttcctcacgcaagaccaaagggtccacctcacgcccccctaaagct
gagcccgagagagtacctgagagagactctgtccaagccacggacctccagcctccaccc
attgcaccccagccccaggacactcttgttggcgaagaacacggctctgcatctccaccc
tccatcttctcatctcctgctccccctctgccccccggtcagacgaccccactacctcca
cctcctctgccctccacccctgttgcccaacttcagccacctacaccccagggccagact
gagtccagcctcgcaccctccacagccctctcctcctcctcattgtcgtctccccagtcc
aaatctcctgcccccatgcccacacgcagccctgcccgtttgacacccatccacaagacc
tccactctgccccccctgcctttaccacccatgctagtgggagactgccaggacagtccg
aagaagtccactcctcctcagaggtcttccaggaaggagaaagaggtgcggaatcggccg
tctctgatcgacctcccgctgccccccacgctggccggaggagacccctcgccccctcag
tcccccgtctacagagctccacctccgccccagtccgctctcaagaagagaccaaagttt
tgctgtccacgctatggcgaacgcaaacagacacagagcgactggggcaaacgctgcgtg
gacaagtttgacatcatcggcattatcggggagggcacctacggccaggtgtacaaggcc
aaggacaaagacaccggtgagctggtggctctgaagaaggtgcgtctagacaatgagaag
gagggcttccccatcacggccatccgagagatcaagatcctccgccagctcaaccaccgc
agcgtggtcaacatgaaggagatcgtcacagacaaacaggacgcactggacttcaagaag
gacaaaggtgccttctacctggtgtttgagtacatggatcatgacctgatgggtctgctg
gagtcggggctgtgtcagttctcccaggaacacgtgaggagcttcatgagacagctgatg
gaggggctggactactgccacaagaagaacttcctgcacagagacatcaagtgctccaac
atactgctcaacaacagtggtcagatcaaactggctgactttggtttggcccgcctctac
aactcagaggaaagtcgaccctacactaataaagtaatcacgctatggtaccgcccccct
gagctcctcctgggagaggagaggtactctccggccatcgacgtctggagctgcgggtgt
attctgggagaattgttcaccaagaagcccatcttccaggccaatcaggagctgctgcag
ttagagttgatcagtcgtctgtgtgggagcccctgtcccgctgcctggcctgacgtcatc
aagctgccctacttcaacaccatgaagcccaagaaacagtaccgccgaaggctacgcgag
gagtttgcctttctgcctgctcaggccctggacctgctggatcgcatgctgacccttgac
cctgcgcggcgctgcacggccgaacaggccctcaatagtgacttcctgtgtaacgtggag
cccagcaagatgtccccgcccaatctccctcactggcaggactgccacgagctgtggagt
aagaaacggcggcgccagcgtcagagcgggctgcccgaggatgtgcctgtgcccaaagtg
ccccgtaaggacccctcaggggcttccagtggagagaacagccggccccaagccagccca
gctggagccccgccccctccgcccggaagaccaccctcctcagccatctcagccaatgag
ctagcaggcctgggtgctgcggcggagcagctgaaccagacagagctggctgtactgttg
aacctgttgcagagacagacagacctcagcctgcctcagatggcccagctcctcaacgtc
tcctccaacccagagagccagcagcagctagagacccttagccagtccctgtctgccctg
accgaggcctcccatcaccggggggcctcagaggatcagggtccggctaggtcccagccc
cccgaacctcccccagagcctcaggagccctccccgcaccacagcgagccgcccctcagc
caggacgaccagaccaacctcctggccctcctattgggccagctcattaagccgcaggcc
gggggggctgagcaaggcgatgagagcaatggcgtccaatcagaggaggctgtgactcgc
ggttcgtctgcctccactgctgatcgcaaggactgtgcagtcaccaagcggaagcagcag
atcggaacaaatcaggtccctccatcctctgagcgacgtcccccctctccgcctggccct
ccaccctcagccctcctcccccctggccagcagcagcccagctctgaaccccagcccggg
cccggtcaggacatcagtcctgcggtggcagctgccctgctgcagctcatttcccagcag
gacccagaggctggggccccccagcgcagcagggaccactccccccgccgtgggcacccc
tgtccggggacagccaccccctgcctggacgactga

DBGET integrated database retrieval system