KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259896Help
Entry
112259896         CDS       T05605                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00564  Glycerophospholipid metabolism
otw00565  Ether lipid metabolism
otw00590  Arachidonic acid metabolism
otw00591  Linoleic acid metabolism
otw00592  alpha-Linolenic acid metabolism
otw01100  Metabolic pathways
otw04010  MAPK signaling pathway
otw04217  Necroptosis
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112259896
   00565 Ether lipid metabolism
    112259896
   00590 Arachidonic acid metabolism
    112259896
   00591 Linoleic acid metabolism
    112259896
   00592 alpha-Linolenic acid metabolism
    112259896
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112259896
   04370 VEGF signaling pathway
    112259896
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112259896
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112259896
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112259896
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     112259896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 112259896
NCBI-ProteinID: XP_024290353
Position
10
AA seq 451 aa AA seqDB search
MKEMNTRCLSEEAHRNSTNPYPIYSAIELEHNKLDCTKAVWFEMTPHESGFSGLGAFVST
SCLGSQFEGGALTEKRKEMDMVLLQGICGSAIADGQRNIAEVIQWIWDLLGGIESMMLKE
NMNMVERSGKVKVCECVPSRVVRCVSELIKYAEDPDPLKTREVITTLGQLLEGLVSSKGE
MLWNMDPERWKRTTLVERKKFIETVSLALILSSDSWAKDWKDKRCNCNDGPKYMMTTGQT
VNFSITNFWIPDGWWILQNISPLVQTWEWGTTSNFLFKVQDTRVPESMASKEKIHLVDAA
LKINSPYPSVLRTSRKVDLIISLDFSEEDPFETVFSAKKYADELKLPFPPVKESVREEKD
HPKGCYVFEGRCPEEPTVMHMPLFNLQNCQDEDEIKKEREKYKTLQLHYGAQEIDHLLEK
ARANMRNNRDRILEQIKMVIQRRKKRMSVAQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatgaacactcgctgtctctctgaagaagctcacaggaacagcaccaacccc
taccccatctacagcgccatagaactggagcacaacaaactggactgcactaaagcggtg
tggtttgagatgaccccccatgagagtggcttctccggattgggagctttcgtctccact
tcctgtcttgggagccagtttgaaggtggagctctgacagagaagaggaaggaaatggac
atggttctgctgcaaggtatctgtgggagtgccattgcagatgggcagaggaacattgcg
gaggtaatacaatggatctgggacttactgggagggatcgagagcatgatgttgaaggag
aacatgaatatggttgagagaagcgggaaggtaaaggtgtgtgagtgtgtgccctcccga
gtggtgaggtgtgtgtctgagctgatcaagtacgctgaggacccagatccactgaagaca
agggaagtcatcaccacactgggacaactactggaaggtcttgtgagcagtaagggtgag
atgctgtggaacatggaccctgagaggtggaagagaaccaccctggtggagagaaagaag
ttcatagagacagtcagtctggcgctcatcctctcctcagacagctgggcaaaagactgg
aaggacaaacgctgcaactgcaacgatggaccaaagtatatgatgactacgggacagacg
gttaatttttcaataacaaacttctggattcctgatggctggtggattctacagaacatt
tcccctctggtccaaacatgggaatggggaaccacatccaacttcctctttaaggtccaa
gatactagagttccggagagcatggcatccaaagagaagattcacctggtagacgctgcg
ttaaagatcaactctccctacccttccgtcctacgcacttcgaggaaggtcgacctcatc
atctccttggacttcagcgaagaagacccatttgagacggtgtttagtgccaaaaagtat
gcggatgagctgaagcttccctttcccccagtgaaggagagtgtgagggaggagaaagac
catcctaagggctgctacgtttttgaggggcgatgccctgaagagcccaccgtcatgcac
atgcccctgttcaacctgcagaactgccaagacgaggacgagattaagaaggagagggag
aagtacaaaacgttacagcttcactacggtgcgcaggagatcgaccacctcctggagaag
gcccgggccaacatgaggaacaacagagacaggatcctggaacagatcaaaatggtcatt
caacgcagaaagaagcgcatgtcagtggctcaatag

DBGET integrated database retrieval system