KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260519
Entry
112260519         CDS       T05605                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112260519
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112260519
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 112260519
NCBI-ProteinID: XP_024291461
Position
10
AA seq 663 aa
MMIPPGDCLYAGRKRRKPIQKQKQTEASQKTNPSKRHRDRLNAELERLASLLPFTPDIIS
KLDKLSVLRLSVSYLRVKSFFQAIQEKPCRKHIMESPVNHQDTRKESLSMGTPGTSSSVV
ESDLLLESLTGFALVVSTDGLIFYTSTSIVDYLGFHQTDVMHQNVFDYIHVEERQEFRRQ
LHWAMNPGTQGASLDQHSATGIGDDFVMSSLFHAQEPDGVPLERTTFLTRCFISRVRCLL
DSTSGFLSMQFQGSLKFLQGQKQKTDSGALLPPQLALFCVAVPLMIPSITEPKMKNTTIR
NKNKGPVIPTPDKHSDKRHRNTRGSCDSSDLLLLNWSSSSTRDPCHYTPWTPLSKDGIRY
RNNGYYTQEEPINFCLSSMGGGPKAQSVNHPWDIRTGSTIRKGPSSSYIPCRQGKYNNLG
KSGAYRMSPGYHAKRQDASQNKLYGGLHSPEAESFCEDGMKADNNYMGGHLDCYNGMVLP
ETTIKTEQDSDSENGCNIYSMPHNLAWVGNEKRYSMAYSEEPQVKSEADYYDQYTTCQRN
KSNMSPTLNGYHKYLYPVGSRAQKDHRIPHSDPLCSSQGANCMVSNVYGNGTVEHKGYIQ
QDNKLNYEFRNHLVHSIKREPMDSPPWSDNGHDISQIPLQRNMIHNCALNDIVHKPNPYI
YMQ
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgatgattccacctggggactgtttatatgctgggaggaagagaaggaagcccatccaa
aaacaaaaacagacagaggccagccagaagaccaacccgtctaagaggcaccgtgaccgt
ctgaatgcagagctggagcggttggccagtctcctacccttcaccccagacatcatctcc
aaactggacaagctctcagtgctgcgcctcagcgtcagctacctccgggtcaaaagcttc
tttcaagccatccaggagaagccatgcagaaagcacatcatggagtcgcctgtgaaccac
caggataccaggaaagagagcctgtccatggggaccccggggaccagcagcagcgtggtg
gagagtgacctcttactggagtccctgactgggtttgccttggtggtgagcacagatggg
ttgatcttctacacctccacctccattgttgactacttgggctttcatcagacggatgtg
atgcaccagaatgtttttgattatatccatgtggaggagcggcaggagttcagaagacaa
ctccactgggccatgaaccccgggacccagggggcctccctggaccagcactcagccaca
ggaattggtgatgactttgtgatgagcagtctcttccatgcccaggagcctgacggtgtt
cctctagagcgcaccaccttcctcacgcgctgtttcatttcccgagtccgttgcttgctg
gacagcacctcaggcttcctgagcatgcagttccagggcagcctgaagttcctgcagggc
cagaagcaaaagacagactccggggcactgctgccaccccagctggccctgttctgtgtg
gccgtgcccctcatgattccctccatcacagagccgaagatgaagaacacgacgatcagg
aacaagaacaagggccccgtcatccccacaccagataagcacagtgacaagaggcatcga
aacaccagaggttcatgtgacagcagtgacttattgcttctgaattggtccagcagctct
accagagacccctgccattataccccatggacacccctctccaaagacggcatcaggtat
aggaacaatggttactacacccaggaggagcccatcaacttctgcctgtcttccatgggt
ggtgggcccaaagctcagagcgtgaatcatccatgggacatccgcaccgggtccaccata
agaaagggccccagcagcagctacataccatgcagacaaggcaagtacaacaacctgggg
aagtctggagcttacaggatgtctccaggatatcacgctaaaagacaggatgcctctcag
aacaaactgtacggaggcctccacagcccagaggcggagagcttctgtgaggacggcatg
aaggcagacaacaactacatgggcggccatcttgactgttacaatggcatggtgttgcct
gagacaaccatcaagacagagcaggactctgactctgagaacggttgcaacatctacagc
atgccccacaacctagcctgggtggggaatgagaagcgctacagcatggcctactcagaa
gaaccccaggtgaagtcggaggctgactactatgaccaatacaccacctgccaaaggaac
aagtccaacatgagcccaacgctcaacggataccacaaatacttatacccagtggggagc
agggctcagaaggatcataggatacctcactcagaccctctgtgtagcagtcagggagca
aactgtatggtcagcaatgtgtatgggaatggtactgtggagcataaaggctacatacag
caagacaacaaactgaactacgagttcaggaatcatctggtccactctataaagagggaa
cccatggactcacctccttggtctgacaatggacatgacattagccaaatacccctgcag
agaaatatgattcacaactgtgcattgaatgatattgtacacaaaccaaacccatatatc
tacatgcaatga

DBGET integrated database retrieval system