KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261397
Entry
112261397         CDS       T05605                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like isoform X1
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112261397
Enzymes [BR:otw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     112261397
SSDB
Motif
Pfam: AstE_AspA DUF1904
Other DBs
NCBI-GeneID: 112261397
NCBI-ProteinID: XP_024292461
Position
11
AA seq 322 aa
MRKKMKKALEMEPVCLPALSRVAICGGTHGNEMSGVYLVRELQRQKLEKAGSATLTTVIS
NPRAVQVCKRYTDMDLNRCFTDAILSSPVTDATPYEVRRAQELNTLLGPKGNVGAMDLVC
DLHNTTANMGLSLISYSVQDWVIMHIYRQVQRKITSAPVRFILLDLPLADAYSQDSLGKH
GFSIEVGPQPHGVVRADIFNIMKEAVDQTLDWVQCFNSGSAFEGGEVDDVYTFVKSVYYP
RDPETNQITAAIHPQVQDHDFCLLHPGDPMFLMFSGEIVKYEGEEVLHPFFVNECAYYEK
SIAFHLARKMTVTIPPLQVKRD
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatgaagaaagcattagagatggagccagtctgtctcccagcgctgtcc
cgagttgccatctgcggcggtacccatggcaacgagatgtcgggcgtgtacctggtgagg
gagctgcagaggcagaagctggagaaggcagggtcagcgaccttgaccacggtcatatcc
aacccacgtgccgtccaagtgtgcaaaagatacaccgacatggacctcaaccgctgtttc
actgacgccatacttagttcacctgtgacggacgccaccccgtacgaggtgaggcgagcc
caagagctgaacacactgcttgggcccaagggcaacgtgggggccatggacctggtgtgt
gacctccacaacaccacagccaacatgggcctcagcctcatctcctactctgtccaagac
tgggtcatcatgcacatctatagacaagtccagaggaagataacctcagcgcccgtgagg
tttatcctgctggatctacccctagctgatgcctactctcaggactccctgggcaagcat
ggcttctcgatagaggtgggacctcaaccccatggtgtggtcagagccgacatcttcaac
atcatgaaggaggcggtcgaccagacactagattgggtccagtgcttcaactcaggaagt
gcctttgaaggtggcgaggtggacgatgtgtacacctttgtgaagagtgtatactaccca
agagacccagagaccaatcaaatcactgctgccatacatccccaagtacaggaccatgac
ttctgcctcctccatccgggagatcccatgttcctgatgttttctggggagatagtgaag
tacgaaggggaagaagtcctccatcccttctttgtgaacgagtgtgcatactatgagaag
agtattgccttccacctggcacgaaagatgacagtcactataccccccttgcaagtgaag
agagattga

DBGET integrated database retrieval system