KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262142Help
Entry
112262142         CDS       T05605                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00051  Fructose and mannose metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    112262142 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112262142 (khk)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     112262142 (khk)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112262142 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 112262142
NCBI-ProteinID: XP_024293628
Position
11
AA seq 303 aa AA seqDB search
MGDKKILCIGLVCLDIINVVDKYPEEDTDTRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSLAPGHVADFIVGDFLRRGVDISSVAWQREGETPCACCVVCPPRGSRTVVLSDTSLHDL
SSISDFSKVDLSQYKWIHWEGRNAEEQVKMIQQVELSNNTLPQQHRITVSVEIEKTREPL
YQLFHYGDVVFVSKDVAMHFGFHSAASALKGLYHRVKKGAVLICAWAEKGADAMGPDGIV
VHSDAFPPEAVVDTLGAGDTFNASVIYTLSNGGGVQEALTFGCQVAGRKCGVHGYDEIVT
KTE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaaaaagatactgtgtatcgggctggtatgtctggatattatcaatgtagtg
gacaaatacccggaagaggacactgacaccaggtgtttgtctcaacgatggcagcgtggt
gggaacgcgtccaactcgtgcactgtgctgtcactccttggcgctccttgtgcgttcatg
gggtccctagctcctgggcatgttgcagacttcatcgtgggcgatttcttgcgccgcggg
gtggacatttcatccgttgcctggcagcgggagggggagaccccgtgtgcctgttgcgtg
gtgtgtccccccagaggctcacgcacggtcgtgctctccgacactagcttgcacgatttg
tcttctatttccgacttctctaaggtagatctcagtcagtacaaatggatccactgggag
ggtcgtaatgccgaggagcaggtgaagatgatccagcaggtggagctgtctaacaacacg
ttgccacagcaacacaggatcaccgtatccgtggagatagagaagaccagggagcctctg
taccagctcttccactatggtgatgtggtgtttgtcagtaaagacgtggccatgcatttt
ggcttccactccgctgccagtgctctgaagggcctctaccacagagtgaagaaaggggct
gtcctcatatgtgcctgggcagagaaaggggcagatgcgatgggtcctgatggcatagtg
gtccactcagatgcctttccaccggaggccgttgtggacacgctcggagcaggcgacact
ttcaatgcttcagtgatctacaccctgtcaaatggaggaggagtacaggaagctctcacg
ttcggttgccaggtggcaggcaggaagtgtggtgtccacggatatgacgaaatagtgaca
aagacagagtga

DBGET integrated database retrieval system