KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262527
Entry
112262527         CDS       T05605                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112262527
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     112262527
Peptidases and inhibitors [BR:otw01002]
 Metallo peptidases
  Family M1
   112262527
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M9_N
Other DBs
NCBI-GeneID: 112262527
NCBI-ProteinID: XP_024293907
Position
12
AA seq 958 aa
MTTLTVTILVLLHVSFAPSLAAQLPGNHDTNDKSSSLLPPVATNGQPFPWVHMRLPETVS
PIHYDLLVHPNLTSLDFTGAVQIQLQVFEDTSTIILHSKELQIAKAELLAPEGPGSLPVP
LQVLEYPAFHQLALMSDVLLVRGGTYKVRLEFSANLSDSFHGFYKSSYRTTTGEVRFMAS
TQFEATSARAAFPCFDEPAFKANFTIQIRRESRHIALSNMPKLKTVELPGGVLEDHFDTS
VRMSTYLVAFIVSDFQSVSKTTSHGVKISVYAVPDKINQTDFALNAAVRLLDFYDDYFDI
PYPLPKQDLAAIPDFQSGAMENWGLTTYREAGLLFDPNKSSASDKLGITMVIAHELAHQW
FGNLVTMQWWNDLWLNEGFAKFMEFVSVNITNPELQVNDFFLGKCFEAMEVDSLSSSHPV
SSQVDTPTQIQEMFDDVSYDKGACILNMLRDFLTPEAFKIGIVRYLRRYSYQNTVNSHLW
ESLTNICQSDDLDEGRLKDDGGFCSQEKAQSGAPKWYSGDQLDVRAIMDTWTLQEGFPLV
TVEVRGRQVRLSQERYLKTDDPSQTHGFLWQVPLTYITSSSNTVHRFLLKTRTDVLYLPE
EVEWVKFNVDMSGYYMVHYEGEGWRSLTSLLLTNHRALSSNDRASLINNAFQLVSVGKVG
LDTALDLSLYLSKETDIMPVTQGLGELVPLYKLMEKRDMEGLENQMKGYIVELFRGLIDR
QTWSDEGSVSQRVLRSYLLLFGSVRNHPHCVATATHLFNKWRASDGNMSLPSDVSLAVFA
IGARDPEGWDFLFEKYRHSQHTSVKSRIKSALSISPLQHKLKRLMEQSLMGEVMKTQDLP
HVVISVSRNPKGYKLAWDFLRHNWHTLVKKFDLGSHSISGMVTGVTNQYSTREMLDEVRG
FFDSLSEETGSGLRCIQQTYESIEENIRWMDQHLPQLKAWLDRQAQGARTETRGHEDL
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgacgacgttaactgtcaccatcctggtgctcctgcatgtatcatttgccccatcttta
gcggcacagcttccaggaaaccatgataccaacgacaagtcttcctcacttctacctccc
gtcgccactaatggccaacctttcccctgggtccacatgagacttcctgaaactgtctct
ccaatccactatgaccttctcgtccaccctaacctgaccagcctagacttcaccggagcg
gtgcagattcaactccaggtcttcgaggacacctctaccatcatcctccacagcaaggaa
ctccagatagctaaagctgagctcttggcaccggaaggtccagggtcactgccagtgcct
ctgcaggtgttggagtacccagccttccaccagctagctctgatgtctgatgtgctgctg
gtcagaggtgggacgtacaaggttcgtctggagttctctgccaacctgtctgacagtttc
cacggtttctacaagagctcctatcgcacaaccacgggagaggtcagatttatggcgtcc
actcagtttgaagcgaccagtgcccgagcagccttcccctgtttcgatgagccggcgttc
aaagccaatttcaccatccagatacgacgggagtcacgccacatcgccctctccaacatg
cccaagctaaagacagtagagttaccaggtggcgtgctggaggaccactttgacaccagc
gttaggatgagcacctacctggtggccttcatcgtctctgacttccagtctgtcagcaag
accaccagtcacggagtcaagatctcagtgtatgctgtaccagacaagatcaaccagaca
gactttgccctgaatgctgcagtcagactgttggacttctacgatgactactttgacatc
ccatatcctctacccaaacaggacctggcagctatcccagacttccagtcgggtgcaatg
gagaactggggtctgaccacataccgagaggctgggctgctctttgaccccaacaagagc
tccgcctctgacaagctaggcatcaccatggtgatcgcacatgagctggcacaccagtgg
ttcggtaacctagtgaccatgcagtggtggaatgacctgtggctcaatgagggctttgca
aagttcatggagtttgtgtcagttaacatcaccaatcctgagctgcaagtgaatgacttc
ttcctagggaagtgttttgaggcgatggaggtggattcattaagctcctcccaccccgtt
tccagccaggtggacactcctactcagatccaggagatgtttgacgatgtatcctacgat
aagggggcgtgtattctgaacatgctgagggacttcctgaccccagaggcgtttaagatt
ggtattgtccgttacctcagacgttacagctatcagaacactgtcaacagccatctgtgg
gagagcctcactaacatctgccagtcagatgatctggatgagggcagactgaaagacgat
ggggggttctgttctcaggaaaaggcccagtctggagctcctaagtggtactcaggcgat
cagctggatgtgagggccatcatggacacgtggacgctgcaggaggggtttcccctggtc
actgtagaggtcaggggtcgccaggtcagactcagccaggagagatacctcaagaccgac
gatccctcacagacacacggcttcctgtggcaggttcctctgacctacatcaccagcagc
tccaacacagtgcatcgcttcctgctcaagaccaggacagacgtgctgtacctaccagag
gaggtggagtgggtcaagtttaacgtggatatgagtggttactacatggtccattacgag
ggggaaggctggcgttctctgacctccctgctgctgaccaatcacagggctctgagctcc
aacgaccgcgcctccctcataaacaatgccttccaattggtcagtgttggtaaggtagga
ctggacacagccttggacctgtctctgtatctgtccaaggagacagacatcatgcctgtc
acccagggtctgggggagctggtccctctctacaaactgatggagaagagagacatggag
ggtctggagaaccagatgaagggctacatcgtggagctgttccggggtttgatagaccgt
cagacgtggagtgacgagggctctgtttcccagagggttctaaggagctacctgctgctg
ttcggttctgtcaggaaccatccccactgtgtcgctaccgccacacacctcttcaacaag
tggagggcctccgacggcaacatgagtctccccagtgatgtcagcttggcggtgtttgcc
attggtgctcgtgacccagaggggtgggatttcctctttgagaagtaccgccattcgcag
cacacatctgtcaagagccgcatcaagtctgccctgtccatcagccctctgcaacacaag
ctaaagcggttaatggagcagagtcttatgggcgaggtgatgaagactcaggaccttcct
catgtggtcatctctgtcagcaggaaccccaaagggtacaagctggcctgggacttcctc
agacacaactggcacacactggtgaagaagtttgacctggggtcccactctatctcaggc
atggtgaccggtgtgaccaaccagtactccaccagggagatgctggacgaggttcgcggg
ttctttgactctctgtctgaggagacaggttctggtctgaggtgtattcagcagacatat
gagagcattgaagagaacatccgctggatggaccagcacctgccccagctaaaggcctgg
ctggacagacaggcccagggagccaggacagagacacggggccacgaggatctatag

DBGET integrated database retrieval system