KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262745Help
Entry
112262745         CDS       T05605                                 

Definition
(RefSeq) septin-5 isoform X1
  KO
K04557  septin 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112262745
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112262745
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    112262745
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     112262745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU AIG1 AAA_16 Dynamin_N Ras Roc AAA_22 AAA_23 AAA_29 AAA_7 ABC_tran NACHT
Motif
Other DBs
NCBI-GeneID: 112262745
NCBI-ProteinID: XP_024294250
Position
12
AA seq 377 aa AA seqDB search
MDAIMLQEKLVERLLCPRVRTARRKEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGM
GKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDA
VNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFM
KALHEKVNVVPLIAKADCLTPNEIKKLKDRVREEIERFGIKVYQFPECDSDEDEEFKQLD
KELKECCPLAVIGSNTVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDL
KDVTCDVHYENYRAQCIQDMTSKLTQDNRMESPIPILPLSTPDVETDRLIKMKDEEWARM
QEMLNKMQQQIHDGKDQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatgctatcatgctgcaggagaaactagtggaacgcttgctgtgccctcgagtcaga
accgcgaggcggaaggagaagcagtatgtgggctttgccaccctccctaaccaggtgcac
aggaagtcagtgaaaaagggttttgacttcactctcatggtcgccggggagtctggtatg
ggtaaatctactcttgtcaacagcctgttcctcacagacctgtacaaggacaggaaacta
ctcaacgctgaggagcgtatcaaccagacagtggaaatcattaagcatacagtggacatt
gaggagaaaggagtgaagctcaaattgaccattgtagacacgccagggtttggagatgct
gtcaacaacaatgaatgctggaagccgatcacagactacatcgaccagcagtttgagcag
tacttcagagatgagagtggactgaacaggaagaatatacaggacaacagagtccactgc
tgcctctactttattcctccgttcggacacggactgcgtccagtagatgttgagtttatg
aaggctctccatgagaaggtgaacgtggttcctctcattgccaaggctgactgtctcact
cccaatgagatcaagaaactcaaagacagggtccgtgaggaaattgagaggtttggcatt
aaggtgtaccagttcccagagtgtgactctgatgaggacgaggagttcaaacaactggac
aaagaactgaaggagtgctgtccgttagcagtaattggcagtaacacagtggttgaggcc
aggggccagagagtgagagggagactctatccatggggtattgtggaagtggagaaccag
tctcactgtgactttgtgaagctgaggaacatgttgattcgctctcacatgcatgacctc
aaagacgtgacatgtgatgtgcactatgagaactatagagcccagtgtatacaggacatg
accagtaaactgacgcaggacaaccgcatggaaagcccgatccccatcctgcccctatcc
accccagatgtggaaacagacagactcatcaagatgaaagatgaagagtgggcgaggatg
caagagatgctaaataagatgcagcagcagatccatgatgggaaggaccagtga

DBGET integrated database retrieval system