KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265074Help
Entry
112265074         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265074
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112265074
   04261 Adrenergic signaling in cardiomyocytes
    112265074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112265074
Ion channels [BR:otw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112265074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF4064 DUF4131
Motif
Other DBs
NCBI-GeneID: 112265074
NCBI-ProteinID: XP_024297867
Position
2
AA seq 280 aa AA seqDB search
MTLCGRKVLTVLSSVFAVCALGLLGIAVSTDYWLYLEEGVILPLNQSTELRMSLHSGLWR
VCFTAGDEKGRCFTIEYVMPTNVQLTSESTVSVLKMIRSATPFPLVSLFFLFIGFVLSNI
GHIRPHRTILAFISGIFFILSGLSLVVGLXLYISSINDEMLNRTKTNEAYFSYQYGWSFA
FAAISFLLTETAGVMSVYLFMKRYTAEEMYRPHPGLYGPRHSNCSDYSGQFLHPDTWDQH
GRSPSSISSEASLQMNHSLHSNYPALLKCPEYDRMSSSPC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtgtggcaggaaggtgttgacagtgctaagcagcgtgttcgctgtgtgtgcc
ctgggcctgctgggcatcgctgtcagtactgactactggctctatctggaggagggcgtc
atcctgcccctcaatcagagcactgagttacgcatgtccctgcactcgggcctctggagg
gtctgcttcacagctggagatgagaagggccgttgtttcaccattgagtatgtgatgccc
accaacgtgcagctgacgtcggagtctacggttagtgtgctgaagatgatccgttcagcc
actcccttccccctggttagtctcttcttcttgttcatcggttttgtcctgagcaacatc
ggacatatccggccccaccgcaccatcctggccttcatctccggaatcttcttcatcctc
tcaggtctgtctctggtggtgggcctgngtttgtacatctccagtattaatgatgagatg
ttgaacaggaccaagaccaacgaggcctacttcagttaccagtatggctggtcctttgct
ttcgctgccatctccttcctgctcactgagacggccggcgtcatgtccgtctacctgttc
atgaagcgctacacggccgaggagatgtacagaccccacccgggcttatacgggccgcgc
cacagcaactgctccgactactctggtcagttcctccacccggacacctgggaccagcac
ggccgcagcccctccagcatctccagcgaagcctcgctccagatgaaccactccctccac
tccaactacccagcgctcctcaagtgtcccgagtatgaccgcatgtcctcctccccatgc
tga

DBGET integrated database retrieval system