KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265675Help
Entry
112265675         CDS       T05605                                 

Definition
(RefSeq) alkaline phosphatase, placental-like isoform X1
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00730  Thiamine metabolism
otw00790  Folate biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    112265675
   00790 Folate biosynthesis
    112265675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112265675
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:otw00537]
    112265675
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     112265675
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112265675
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:otw00537]
 Enzymes
  112265675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 112265675
NCBI-ProteinID: XP_024298976
Position
13
AA seq 455 aa AA seqDB search
METQKWSIVALCLLGVLGSTTAKVSVSGPVEEENPEFWRAQGAKALQAALNRKLNTNVAK
NIMLFLGDGMGITTITAARILKGQMHNQSGEETVMTMDTFPHTGLLKTYSVDFQIPDSSS
TATAYLCGVKTNLNTVGVNAAARNGICKTQKGNEVTSILKWAKDAGKSVGIVTTTRVQHA
TPATTYAHSASRKWYSDADMPASAKKEGCTDIASQLLKNTDIDVIIGGGRKYMTPKGTWD
PEYPRDLSSSGKRQDGRHLISDWQKMKVGKVARYVWNRTDFDAVDPDTTDYLMALFEPGD
LRFDVERDPTMDPSIAETTEKAIRILSKNPKGFFLLVEGGRIDQGHHASRASMALHETVA
FDNAVAKGLELTNEEETLTLVTADHSHAFTFNGYPFRGQSILGKSPLYGKDMRPYTTLMY
GNGPGYKVVETSALTSESGYTVEGLRAAVCGAPGH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcagaaatggtctatcgtggccctgtgtctgctgggggttttgggttcaacc
accgccaaagtctctgtctctggtccagttgaggaagagaacccagagttctggagagcc
cagggtgcgaaggctttgcaagcagcgctgaacaggaagttgaacaccaatgtggccaaa
aacatcatgctcttcctgggtgatggtatgggcattaccaccatcacagcagctcgaatc
ctcaagggccagatgcacaaccagtctggagaggagacagtgatgaccatggatactttc
ccccatacgggcctcctcaagacatacagtgttgacttccagatccctgacagttcatcc
acagccacagcctacctgtgtggtgttaagaccaacctgaacacggtcggtgtgaatgct
gctgctcgcaacggaatctgcaagacccagaagggcaacgaggtcacctctattctcaag
tgggccaaagatgctggtaaatcggttggcatcgtcacaacaacgcgggtccagcatgca
actcctgccacaacctatgcccacagtgccagcaggaagtggtacagcgatgcagacatg
cccgcctctgccaagaaagaaggatgcacagacattgcctctcagctcctaaaaaacact
gacattgatgtgatcatcggcggggggaggaagtacatgacccctaagggcacctgggat
ccagagtacccccgagacttgtcctccagtggcaagagacaggacggacgccacctcatc
tctgactggcagaagatgaaagtcggaaaggtggctcgttacgtgtggaacaggactgac
tttgacgctgtggaccctgacaccactgactaccttatggccctgtttgagcctggagac
ctgcgctttgacgtggagagagaccccaccatggacccttccatcgctgagaccacagaa
aaggccatccgcatcctcagcaaaaaccccaagggattcttcctcctggtagaaggtgga
cgtatcgaccagggccaccatgccagcagagcctccatggcgttgcacgagacggttgcc
tttgacaatgctgtcgccaagggcctggagctgaccaatgaggaggagactctcaccctg
gtgacagctgaccactcccacgccttcaccttcaatggatacccctttagagggcaaagc
attctggggaaatctcctctgtatgggaaggatatgcggccttacacaaccctgatgtac
ggaaacggccctggatacaaagtcgtagaaacaagcgccctgacatcggaaagtggatac
acagtcgaaggactacgtgcagctgtctgcggtgcccctggacactga

DBGET integrated database retrieval system