KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267385
Entry
112267385         CDS       T05605                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112267385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112267385
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    112267385
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-BED PyrI_C zf-C2H2_11 zf-C2H2_8 zinc_ribbon_15
Other DBs
NCBI-GeneID: 112267385
NCBI-ProteinID: XP_024301431
Position
14
AA seq 1197 aa
MTRMGQRHPDPGPSSWPLSSPGLPFPGSLEELSTAKSTLQLPNTNQHDPTGTQPCLPEQW
VSVPAQCASPVCQPSVPAQCASPVCQPSVPAQHARRHQKQQGSYEYWHRDKERAQYFLEC
SRVHGEELLLYLREDRIAVRIVTSFFESVSELLDHQKVPLGHPTHSAFLGNPEGQVFRRD
TQVNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFS
NLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAHAQGMSLPG
VPGAMDKAAMGGMGHSSASLADYFGNRHHSGLTFPSAPGFPFSFPGLFSSGLYHRPTLIP
ATSPVRRPPGPGTEHSKGPLLSPSPRAQEARELLKTLRKEASPGNEQPQGTEQRQAQGSS
SKQRHGGGKMSSQSESSDLDDVSTPSGSDLDTTSGSELESDMESEGQRERAPRENGKGPK
RKAGGGPQSPTILTSNHTKEFQGGPALFPPSLDEHTAVSGAVNDSIKAIASIAERYFGST
GLAGLQDKKVGALPYPSMFPLPFFPTFSPPVYPFQERELRPAGLKGEPQSPPDEPTKKGQ
SRTSESPFDLTTKRKQEEKVPAPFTPVSNSKPEASSRSTNQDQPLDLSMGGTRHRSSSRT
SRREESKKIHVFGEDMAGVELPKADTSLQHARPTPFFMDPIYRVEKRKMNDPFEALKDKY
MRPAPGFLFHPQFRMPDQRSWMSAIENMAEKLETFGSLNPESGDLMRSVPSMFDFRAPPT
ALPETLLRKGKERYTCRYCGKLFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
IRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPRSELDSSSAILDDK
EDSYFNEIRNFIGNTGQNQPSPDHSEEGLNGGPFEEEKPLMASQGSRDLEEGEGEELGAE
EEEEEGEQSDSAAGKPRDEAPPSNLDDDIIHNEIEFDGPSDLDLNCKTSPRSYEEEEDQS
SYSALDHIRHFSDMHKMEDSEFSDGDGTAFGSPSLPEAVKQPLYRKSKSQAYAMMLSLAD
KDALHPANHTPATMWHSLARAAAESSAIQSLSHGYDTRSLTSNPPPPPRPQPIALGALGG
RQQGPWPLARHRLPSRTTAHLTAEQNALHTSRVTVHREPPSPALQEIQQNIPPVTLN
NT seq 3594 nt   +upstreamnt  +downstreamnt
atgacccggatgggtcagcgacacccagaccctggtccctcctcctggcccctgtctagc
cctggccttcccttccctggctctctggaggagctctccactgccaagtccacactgcag
ctgcccaacacaaaccagcatgacccaaccggcacacagccctgcttgcctgaacaatgg
gtgagtgtgccagcccagtgtgccagcccagtgtgccagcccagtgtgccagcccagtgt
gccagcccagtgtgccagcccagcgtgccagcccagcatgccaggagacaccagaagcaa
cagggaagctatgaatactggcacagggacaaggagagggcacagtattttctcgagtgc
tcgagagtccacggagaggagctgcttctgtacctgagagaggaccgtatcgctgtgagg
attgtgaccagcttctttgagtctgtctctgagctgctggaccaccagaaggttccgttg
ggacacccaacccactcagccttcctggggaacccggagggacaagtgtttcgacgagac
acccaagttaacctgcagaggcacatccgctcgcagcacgtgggggcgcgggctcacgcc
tgtcccgattgcgggaagacctttgccacgtcctctggcctgaagcagcacaagcacatc
cacagcagtgtcaagcccttcatatgcgaggtgtgccacaagtcctatacgcagttctcc
aacctgtgccgccacaagcgcatgcacgccgactgccgtacccagatcaagtgtaaggac
tgtggccagatgttcagcaccacctcctccctcaacaagcaccgacgcttctgtgagggc
aaaaaccatttcacggcaggggggttgtttgcccatgcccaaggcatgtccctccccggt
gtccctggtgccatggacaaggccgctatgggtgggatggggcacagcagtgccagcctg
gcagactactttgggaaccggcaccacagtggcctgacgtttccatccgcccctggcttc
cccttcagcttcccgggcctgttctcttctggactgtaccaccgacccaccctcatcccg
gccacctccccagtcagacggcccccaggtccaggtacagagcacagcaagggccccctc
ctgtcgcccagccctagggcccaggaggccagagagctgctcaagaccctccgcaaggag
gcatcgcccggcaacgagcagcctcaggggacagagcagcgacaggcccagggctcctcc
tccaagcagaggcatggcggcggcaagatgagcagccaatcagagagcagcgacctggat
gacgtgagcacgcccagtgggagcgacctggataccacgtcaggctcggagctggagagc
gacatggagagcgaaggccagcgggagagggcaccccgggagaacgggaaggggcccaag
aggaaggcgggcggaggcccccagagccccaccatcctgaccagtaaccatactaaggag
ttccaaggcggccccgccttgttccctccctcgctggacgagcacacggctgtctcaggg
gcggtcaatgactccatcaaggccatcgcctccattgctgagaggtactttggctccacg
gggctggcgggcctgcaggacaagaaggtaggcgccctgccctacccctccatgttcccc
ctgcccttcttcccaaccttctccccacccgtctaccccttccaagagagagagctcaga
cctgcaggcctcaagggggagccccagtccccacctgatgaacccaccaagaaaggccag
agcaggacctctgagtcgccctttgaccttaccaccaagcgcaagcaggaggagaaggtc
cccgccccctttacccccgtctccaattccaaaccggaggcctcctcacgttccaccaat
caggatcagccgctggatttgagcatgggtggcacgaggcaccgcagcagtagccgcacc
tcccggagggaggagtcgaagaagatccacgtgtttggagaagacatggcaggggtggag
cttcctaaagccgacacctctctgcagcacgctaggcccacccccttcttcatggaccca
atctacagggttgagaagaggaagatgaacgatccgtttgaggctctgaaagacaagtac
atgcggcctgcccccggcttcctcttccatccacagtttcgtatgccagatcagagatcc
tggatgtcggccattgagaacatggcggagaagctggagacgtttggttcgcttaacccc
gagtcaggtgacctgatgcgctccgtcccctccatgtttgacttccgagccccgcccact
gccctccccgagacgctattgcgcaagggcaaggagcgctacacctgcagatactgcggt
aaactattcccacggtctgccaacctgacccgccacttaaggacacacacgggagagcaa
ccgtacaggtgtaagtactgcgaccgctcgttcagcatctcctccaacctgcagcgccac
atccgcaacatccacaacaaggagaagcccttcaagtgtcacctgtgtgaccgctgcttc
ggccagcagaccaacctggaccgtcacctcaagaagcacgagaacggtaacctctcagga
acggctgcgtcctcccctcggtcagagctggacagcagcagtgccatcctggacgacaaa
gaggactcctacttcaacgaaatacgaaactttatcggcaacacaggccagaaccagccg
tcccctgaccattctgaggaagggttgaacgggggtcctttcgaggaggagaagcccctg
atggccagccaagggtcacgtgacctggaggagggggagggggaggagcttggcgccgag
gaggaggaggaggaaggggagcagagcgactccgctgctgggaaacctagagacgaagct
ccccccagcaacctagatgatgacatcatacacaacgaaatagaatttgacggacctagt
gatttggacctcaactgcaagacctccccaaggagctatgaggaggaagaggatcagagt
agctactctgcgctggatcacatccgtcacttctctgacatgcataagatggaggacagt
gagttcagtgacggggacggcactgccttcggctcccccagcctgcctgaggccgtcaaa
cagcccctgtacaggaaatccaagtcccaggcgtacgccatgatgctgtctctggctgac
aaggacgcactccacccagccaaccacacaccagccaccatgtggcacagcctggcgcgg
gccgctgctgagtccagtgccatccagtccctcagccatggttatgatacccgatccctg
acctctaacccccccccccccccccgaccccaacctatcgcactgggagcccttgggggc
cgtcagcagggcccctggcccttggcccgtcacagactgccgagcagaaccacggcccat
ctgactgctgagcagaatgccttacacacgagcagggtcaccgtccacagagaaccgccc
agcccagccctccaagagatccaacaaaacatccctcctgtgaccttaaattga

DBGET integrated database retrieval system