KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267547Help
Entry
112267547         CDS       T05605                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw01100  Metabolic pathways
otw04270  Vascular smooth muscle contraction
otw04540  Gap junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112267547
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112267547
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112267547
Enzymes [BR:otw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     112267547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 112267547
NCBI-ProteinID: XP_024301536
Position
14
AA seq 823 aa AA seqDB search
MWSTWGRVRARIHWELRFLNKVSAESKPKEMYGFINTCLKSLVVDKFGEETWMKLRDEAG
VQDTFLTYEVYKDDITMQLVAAACKLLDVKPEVVLRQFGEYFFDFCKRSGYDHMLRTLGG
NLFEFIENLDALHSYLALSYKEMNAPSFRAERNCDGTMFLHYYSDRRGLCQIVPGIIEAV
AKDFFNSEITMEIVNQIEELERTGKKEHVVFLVTQKPTFSNVMCSNKLSQTPPCLPRGPR
RNTMHWNPNKEDMQKSLQRKLQSQGFSMCRNHWETVRGLVQLGKGKLLRGFEPVYPKNLC
IDLKTFCNAFPFHIVFDKELVVRQAGVNVQKIVPGLQTMSIHLDQYFSIVHPEVTFTISS
IRKFINSHFVLQTRRDMMPEAWRDRPMLELRGQMLWMESLQCMLYQASPLLRSLHELEER
SMHISDIAPHDVTRDLILLNQQRLAEMELSNQLERKKEELRHLSQHLEEERTKTENLLYA
MLPKHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICSECEPIQIVNMLNSMYLKFDRL
TTVHTVYKVETIGDAYMVVGGVPIPVSSHAERVANFALGMVIAAREVINPITGGPIQIRV
GVHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPNKIHLSPSVYLVLKDKGFMIQE
RGEIDVKGKGRMSTYFLEGNLTATEHEIMGRSVKEADSGRASVQSARDCNTEAALYRPAI
QRVQSEDRNPVVPMEYGDSLADPPPSVQLIEPQPQVRAKSLKGKPRDSESYGSLHSDKKS
VEGGLPKPDHQLTRATLSQSPTPIEADAPHSTKHIRTSFCVVL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcaacttggggtcgtgttcgtgcaaggatacattgggaattaaggtttttaaac
aaagtgtcggcagaatccaaaccaaaagagatgtatggatttatcaatacctgtttgaag
tcgctggttgttgacaagtttggcgaggagacatggatgaagctcagagatgaggccggg
gttcaagatacattcttgacatatgaagtgtacaaagacgacatcaccatgcaactggtg
gctgcggcctgcaagctacttgatgttaaaccagaggtggtgttgagacaatttggggaa
tacttttttgacttttgtaaacgatctggatacgaccacatgttacggactctgggaggg
aacctgttcgagtttatagagaatctggatgcactgcacagctacctcgccctttcttac
aaggagatgaacgcgccatcatttagagcagagaggaactgtgacggcacgatgtttctt
cactattactccgaccgccgaggcctatgccaaattgtgcccggtatcattgaagctgta
gcaaaagacttcttcaacagcgagataacgatggaaatcgtcaaccaaatagaggaacta
gagaggacaggaaagaaggagcatgtagtattccttgtcactcagaaacctacattttcg
aatgtaatgtgcagtaacaagctctcacaaacaccgccatgtttgccaagaggccccagg
cgcaacacaatgcactggaacccaaacaaggaggacatgcagaaatcattgcagaggaaa
ctccaatctcagggattttccatgtgtcggaaccactgggagactgtgagggggttggtc
cagcttgggaagggcaaactcttgagaggatttgagccagtctacccgaagaacctttgc
atcgacctgaagacattttgcaatgcctttcccttccatatagtgttcgacaaggagctg
gtggtgagacaagcgggggtgaatgtccagaagatcgtccccgggctgcagaccatgagc
attcacctggatcagtacttcagtatcgtccaccccgaggtcaccttcaccatctccagc
atcaggaagttcatcaacagccactttgtcctgcagacgcgacgggacatgatgcccgag
gcctggagggatagacccatgctggagctcagaggtcagatgttgtggatggagtctctg
cagtgcatgctgtaccaggcctcccctttgctgcggagcctccacgagctggaggagcgg
agcatgcacatctctgacatcgcgcctcacgacgtcacgcgggacctcatcctgctcaac
cagcagcggctggccgagatggagctctccaaccagctggagaggaagaaggaggagctc
cgacacctgtcccagcatctggaggaggagaggaccaagacggagaacctgctgtacgcc
atgctacccaaacatgtggccaaccagctgaaggaggggaagagagtggaagcaggagag
ttcaaggagtgcaccatcctcttcagtgatgtggtcaccttcaccaacatctgctcggag
tgtgagcccatccagatcgtcaacatgcttaactccatgtacctcaagttcgaccggctc
accacagtacacacagtttacaaggtggagaccataggtgatgcctacatggtggtaggt
ggcgtgcccatcccagtgtccagccatgctgagagggtggccaacttcgccctgggcatg
gtcatagcagctagggaggtcatcaaccccatcacaggggggcctatccagattcgggtg
ggtgtacacagcgggccagttctagctggtgtggtgggggagaagatgcctcggtactgc
ctgttcggagacacagtaaacacggcgtctcgcatggagagccacggcctccccaacaag
atccacctcagccccagtgtttacctggttctgaaagacaagggcttcatgatccaggag
cgaggggagatcgatgtgaaggggaagggcaggatgtccacctacttcctggaagggaac
ctgaccgccacggagcacgagatcatgggccgttcagttaaggaggccgactcgggccgt
gcgtctgtacagtcggcacgggactgcaacacagaggcagccctgtacagaccggccatc
cagagggtgcagagtgaggacaggaatcctgtagtgcccatggagtatggagacagcctg
gccgacccgccgccctcagtccagctcattgaaccccagccacaagtcagagccaagagc
ctcaaaggaaaacctcgggactcagagagctacggcagtctccacagtgacaagaagtca
gtggagggaggtctccccaaaccagaccaccagctgaccagagcaaccttgtcccagagt
cccactcccatagaggctgatgctcctcattccaccaaacacatccggaccagtttctgt
gtggtcctctga

DBGET integrated database retrieval system