KEGG   Oligella urethralis: CEQ07_00960Help
Entry
CEQ07_00960       CDS       T05343                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
our  Oligella urethralis
Pathway
our00860  Porphyrin and chlorophyll metabolism
our01100  Metabolic pathways
our01110  Biosynthesis of secondary metabolites
our01120  Microbial metabolism in diverse environments
Module
our_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEQ07_00960 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:our01007]
    CEQ07_00960 (hemL)
Enzymes [BR:our01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CEQ07_00960 (hemL)
Amino acid related enzymes [BR:our01007]
 Aminotransferase (transaminase)
  Class III
   CEQ07_00960 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVL70142
Position
complement(214132..215412)
Genome map
AA seq 426 aa AA seqDB search
MTTNQALFDRACLTIPGGVNSPVRAFKSVGGTPRFIAKAEGAYMWDAEGNRFIDYLGSWG
PAIVGHAHPEVVEAVQEAAARGLSYGAPTEAEILLAEKITQLLAPVEKVRLVSSGTEATM
SAIRLARGATNRNKIIKFEGCYHGHSDSLLVKAGSGLLTFGNPSSAGVPEEFVKHTLVLE
FNNLDSVRAAFEAHPEDIACIIVEPYAGNMNLIKAKAGFLEGLRSLCDEYGALLIFDEVM
TGFRAGPRGVQGITGIMPDLITLGKVIGGGMPVGAFGGRADIMEHIAPLGAVYQAGTLSG
NPVSVAAGLKTLEIITRDGFYEQLTAQMEKMITGLVEEAKKAGVTFSADFAGGMFGLYFT
EKVPTNFAEVSASDQDAFNQFFHHMLEHGVHLAPSGFEAGFISAAHNDEVIEETLQAARA
SFKKLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatcaagctttatttgaccgcgcctgcttaactattcctggcggcgttaac
tcacctgtgcgtgcatttaaatccgttggcggcaccccgcgctttattgccaaagccgag
ggcgcttatatgtgggatgccgagggtaatcgctttatcgattatttaggctcatggggt
ccagccattgtggggcacgctcaccccgaggtggttgaagcggtacaagaagcggcggca
cgtggtctatcctatggcgctcccaccgaagctgaaattttactggctgaaaagatcacc
cagttgcttgccccagtggaaaaagttcgcttagtcagttccggcacggaagccaccatg
agtgcgattcgtttagctcgcggtgcaaccaatcgcaacaagatcattaaattcgagggc
tgctatcacggtcactccgatagtttattggtaaaagctggctctggcctactgaccttc
ggcaacccctcttctgccggcgtaccggaggagtttgttaaacacaccttagtgctagag
tttaataatttagactcggtacgtgccgcttttgaagcccatccagaggatattgcttgc
attattgtagaaccctatgctggcaatatgaatttaatcaaagctaaggccggcttttta
gagggcttgcgtagtttatgtgatgagtacggcgccctacttatctttgatgaggtcatg
acaggtttccgtgccggtcctagaggagtacagggtatcaccgggattatgcccgatctt
atcactctaggtaaggtcatcggtggcgggatgccagtgggtgcctttggtggtcgtgcg
gatattatggagcacattgcgccactcggcgcagtgtatcaagctggtaccctatccggt
aatccagtctcagttgccgctggtttaaaaacgctcgaaatcatcacgcgtgacggcttc
tatgagcaactgactgcgcaaatggaaaagatgatcactggcttagtcgaggaagcgaaa
aaggctggcgtcacctttagtgcagattttgcaggcggtatgtttggcctgtactttacg
gaaaaagtaccgaccaactttgccgaagtatccgccagcgatcaggatgcctttaatcag
ttcttccaccatatgctagaacacggcgtacaccttgctccctcaggctttgaggcaggc
tttatctccgccgcgcataatgacgaggtcatcgaagaaacgctacaagccgctcgcgcc
agtttcaaaaaactcgcttaa

DBGET integrated database retrieval system