KEGG   Oligella urethralis: CEQ07_09010Help
Entry
CEQ07_09010       CDS       T05343                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
our  Oligella urethralis
Pathway
our00020  Citrate cycle (TCA cycle)
our00620  Pyruvate metabolism
our00650  Butanoate metabolism
our01100  Metabolic pathways
our01110  Biosynthesis of secondary metabolites
our01120  Microbial metabolism in diverse environments
our01130  Biosynthesis of antibiotics
our01200  Carbon metabolism
Module
our_M00009  Citrate cycle (TCA cycle, Krebs cycle)
our_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEQ07_09010
   00620 Pyruvate metabolism
    CEQ07_09010
   00650 Butanoate metabolism
    CEQ07_09010
Enzymes [BR:our01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CEQ07_09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AVL71543
Position
1884548..1886125
Genome map
AA seq 525 aa AA seqDB search
MSQKFESLSRIKNKGYHSLVMSAEEAVKKIPSGVNVGMSGFTGSGYPKEIPVALAARIRE
EHAQNRPFKIGVWTGASTAPELDGALAEVDGIEMRLPYQSDPTCRKKINSGKMQYMDIHL
SHVAQHAWFGFYGKLNIAVIEVAGIREDGSLIPAGSVGNNKTWIDQADQVIIEVNYALSE
KLDGMHDIYYGTALPPHRKPIPIVEVADRIGQPYYHCPAEKIIAIVETHGTDRVNVFTEP
DAASKKIAEHILNFLRDEVNKGVLPPNLLPIQSGVGNIANAVMAGLNEGDFDNLTSYTEV
IQDGMLNMIKSGKLVKVSATSLSLSPAGLEELNKNIDFYRERIVLRTQEISNHPEVVRRL
GVIAINGMVEADIYGNVNSTHVMGSDIINGIGGSGDFARNGFLCFFVRPSIAKGGDISGI
VPMVSHVDHTEHDSQILVTEQGLADLRGLSPRQRAERIIEHCAHPDYRAELRSYFERACA
ENSGHTPHILSEALSWHDRFNKTGSMKITAASTEQVAASKDSETN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaagtttgagtctctatcacgaattaagaataagggctatcacagtttagtt
atgtcagcggaggaggctgtcaaaaagattccttcaggcgtcaatgtgggaatgagtggt
tttactggttccggctatcccaaagagattccagttgccctagcggcacgcattcgtgaa
gagcacgctcaaaacaggccttttaaaatcggcgtttggaccggcgcctctaccgcaccc
gaattagatggtgccttggctgaggtggacggcattgagatgcgactgccctatcaatcg
gacccgacatgtcgcaaaaaaattaatagcggcaaaatgcagtacatggatattcatctt
tctcatgtggcgcagcatgcgtggttcggtttttacggtaaattaaatattgctgtgatt
gaggtcgcaggtattcgtgaagacggcagtttaattcctgccggttccgtgggtaataac
aagacctggatcgaccaagcagatcaggtcattattgaggtcaactacgcactaagtgaa
aaacttgacggcatgcatgatatttactacggcactgccctcccaccgcatcgtaagccg
atacccattgttgaggtcgctgatcgcatcggccagccttactaccattgccccgccgaa
aaaatcattgccattgtcgaaacccacggcaccgatcgggttaacgtctttactgagccg
gatgcggcttcgaagaagattgccgagcatattctaaacttcttaagagatgaggtaaat
aagggggtgttaccgccgaatttactaccgattcagtctggcgtgggtaatattgcaaat
gccgtgatggccggtttaaatgagggtgattttgataatctgacctcctataccgaagtc
attcaagacggcatgctgaatatgatcaaatcaggcaagctggttaaagtctcagccacc
tcgctatcccttagcccagcgggcctagaagagcttaataaaaatatcgatttctaccgt
gagcgcattgttttacgcactcaggaaatcagtaatcacccagaggtggtgcgtcgtctc
ggcgtgattgcgattaacggtatggtagaagcggatatttacggcaacgtcaactccacc
cacgtgatgggtagtgacatcatcaacggcattggtggctccggcgactttgcacgaaat
ggcttcctctgcttctttgtacgtccgtccattgccaaaggcggtgatatttccggtatt
gtgcccatggtgtctcacgttgaccatacggagcatgactcacaaatcctcgtcaccgaa
cagggtttagccgatttacgtggtttatcaccgcgccaacgcgccgaacgcattattgag
cattgcgcccatcctgactatcgtgctgagctacgctcctacttcgagcgtgcttgtgcg
gaaaatagtggtcataccccacatattttaagtgaggccttaagctggcacgatcgcttt
aataaaaccggcagcatgaaaatcaccgccgctagtactgagcaggtggctgcttctaaa
gacagtgagactaactaa

DBGET integrated database retrieval system