KEGG   Oligella urethralis: CEQ07_09610Help
Entry
CEQ07_09610       CDS       T05343                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
our  Oligella urethralis
Pathway
our00740  Riboflavin metabolism
our00790  Folate biosynthesis
our01100  Metabolic pathways
our01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CEQ07_09610 (ribB)
   00790 Folate biosynthesis
    CEQ07_09610 (ribB)
Enzymes [BR:our01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CEQ07_09610 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CEQ07_09610 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AVL72180
Position
complement(2011083..2012270)
Genome map
AA seq 395 aa AA seqDB search
MSSADSLSNDLVESGESASVISSVTEIIEELRQGRMVILVDEEDRENEGDLLMAADFVTP
EAINFMVTHARGLVCLTLTGERSDQLGLGLMTSNNQSGFETNFTISIEAAEGVTTGISAA
DRATTIKAAVAPDATPEDVVSPGHIFPVRAVPGGVLIRAGHTEAGCDLTAMAGLTPAAVI
CEILKPDGEMARLPDLIEFSKEFGIKIGTIEDLIQYRSEHESMIKRLGSKQMMTPWGSFQ
AVSYQDKTSGATHIALVHGEIHPEREVLVRVHEPVTMLDILDCEDKSHSWGVAASLKAIS
DAESGVMVMLNCDQSHSSAEVANQVSTWGAEAVPEAPKGRKHDRYNLRTYGVGAQILKDL
NVSQMRLMATPVKMPSMAGFGLTITGFYQEQSHDA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgcagacagtctttctaatgaccttgttgaaagcggtgaaagtgcctccgtc
atttcctccgtcactgagattattgaggagttacgccaagggcggatggtgattctggtt
gacgaagaggatcgcgaaaacgagggcgatctgctgatggcggcggattttgtgacccct
gaagcgattaactttatggtcacccatgctcgtggtttagtctgtttgaccctaaccggt
gagcgtagcgatcagcttggtttaggcttgatgacaagtaataatcagagcggctttgaa
acaaactttaccatttccattgaagccgcagagggggtgaccaccggaatttctgccgct
gatcgagcaaccaccattaaagcagcggtagcgccggatgcgacgccggaggatgtggtg
tcgccgggtcatattttcccggtgcgggcggtgcctggcggtgtcttgattcgtgccggt
cataccgaggcaggttgtgacctgacggcaatggcgggcttgacgccggcagcggtgatt
tgtgagattctaaaacccgatggggagatggcgcgtttgccggatttgatcgagttttca
aaggagttcggcatcaaaatcggtactattgaggatttgattcagtaccgtagtgagcat
gaatccatgatcaaacgcttgggctccaagcagatgatgactccttggggtagcttccaa
gcggtttcttatcaggataaaaccagcggtgcgacccatattgccttagtgcatggtgag
attcatcctgagcgtgaggtcttggtgcgagtgcatgagccggtgacgatgttggatatt
cttgattgtgaggataagtcgcacagctggggcgtagcggcttccctaaaggcgattagt
gatgccgagagcggggtgatggtgatgttaaattgtgatcaaagccatagcagtgccgag
gtggctaatcaggtctcgacttggggggctgaggcggtgccagaagcgcctaaaggacgt
aagcatgatcgctataatttacgtacctatggtgtgggtgcacaaattttaaaggatttg
aatgtttctcaaatgcgtttaatggcgacaccagttaaaatgccaagtatggctggtttc
ggtttgaccataaccggtttttatcaagagcaatctcatgatgcctag

DBGET integrated database retrieval system