KEGG   Oligella urethralis: CEQ07_10830Help
Entry
CEQ07_10830       CDS       T05343                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
our  Oligella urethralis
Pathway
our03010  Ribosome
Brite
KEGG Orthology (KO) [BR:our00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CEQ07_10830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:our03011]
    CEQ07_10830
Ribosome [BR:our03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CEQ07_10830
  Bacteria
    CEQ07_10830
  Archaea
    CEQ07_10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AVL71866
UniProt: A0A2N6QA24
Position
complement(2262901..2263230)
Genome map
AA seq 109 aa AA seqDB search
METTAIVRNAHISAQKTRLVADLIRGKSVEQALNILTFTPKKAAGIIKKALESAIANAEH
NDGADIDELIVKTIYVDKAQSMKRFRARAKGRGNRIEKQTCHIVVKVGV
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacagctattgttcgtaacgcacatatctcagcgcaaaagactcgtcttgta
gcggacttaatccgtggtaaatcagttgagcaagcgttgaatattttgacgttcacaccg
aaaaaagccgccggcatcatcaaaaaagctctagagtcagcaatcgctaacgctgagcac
aatgacggtgctgatattgatgagttaatcgtaaaaactatttacgttgataaggctcaa
tcaatgaagcgttttagagcacgtgccaaaggccgtggtaaccgtattgagaagcagact
tgccacatcgtggtaaaagtcggcgtttaa

DBGET integrated database retrieval system