KEGG   Oscillibacter valericigenes: OBV_02900Help
Entry
OBV_02900         CDS       T01636                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00071  Fatty acid degradation
ova00072  Synthesis and degradation of ketone bodies
ova00280  Valine, leucine and isoleucine degradation
ova00310  Lysine degradation
ova00362  Benzoate degradation
ova00620  Pyruvate metabolism
ova00630  Glyoxylate and dicarboxylate metabolism
ova00640  Propanoate metabolism
ova00650  Butanoate metabolism
ova00900  Terpenoid backbone biosynthesis
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
ova01212  Fatty acid metabolism
ova02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ova00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OBV_02900
   00630 Glyoxylate and dicarboxylate metabolism
    OBV_02900
   00640 Propanoate metabolism
    OBV_02900
   00650 Butanoate metabolism
    OBV_02900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OBV_02900
   00072 Synthesis and degradation of ketone bodies
    OBV_02900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OBV_02900
   00310 Lysine degradation
    OBV_02900
   00380 Tryptophan metabolism
    OBV_02900
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OBV_02900
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OBV_02900
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OBV_02900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ova04147]
    OBV_02900
Enzymes [BR:ova01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OBV_02900
Exosome [BR:ova04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OBV_02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAK97488
UniProt: G4KRL8
Position
complement(278460..279716)
Genome map
AA seq 418 aa AA seqDB search
MKELYVVNCCRTAIGSFGGSLKNTPAAEMGAIVVKEALNRAGVKPEQVDEVMFGCILTAG
LGQNVARQVSIKAGIPYSVPAYTVGMVCGSGMKSVIEGARSILAGDADVIVCGGTENMSA
APYSAPDARWGARMGDKKMVDTMIKDGLWDAFNNYHMGTTAENIADVWGITRQEMDEFAA
SSQQKCEAAQNSGRFDDEIVPVPVKVKKQIVEFKKDEFPRAGTTVEGISKLKGAFPVGPE
SPNPQVVHTFEPTGFKDAADKGTPRVTAASASGINDGAAAIVLASGEAVKKYGLKPMAKL
VSWGQGAVDPKIMGVGPVPASKQAMAKANLSINDMDLVEANEAFAAQSIAVARELKFDMS
KVNVNGGALSLGHPVGCSGARIIVTLLHEMQKRPDAKKGLATLCIGGGQGVATIYEKC
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactttatgtcgtgaactgctgccgtacagccattggttcctttggcggctct
ctgaaaaacacccctgccgccgaaatgggtgctattgtcgtcaaagaggccctgaatcgc
gccggtgtgaagcccgagcaggttgacgaagtgatgttcggctgcattctgaccgcaggc
cttggacagaacgttgcccgtcaagtttctattaaggccggtattccctattccgttcct
gcttacaccgtgggtatggtctgcggttccggtatgaagtccgtcatcgagggcgcccgc
tccattctggctggcgacgcggatgtaatcgtctgcggcggcaccgagaatatgtccgcc
gctccctattccgctcccgacgcccgctggggcgcccgcatgggtgacaagaagatggtc
gacaccatgatcaaggatggcctgtgggatgcgttcaataactatcacatgggcaccact
gctgagaatattgccgatgtctggggcatcacccgtcaggagatggatgaattcgccgca
tcctcccagcaaaagtgcgaggcagcccaaaattccggcagattcgacgacgagatcgtt
cccgttcccgtgaaagtcaaaaagcagatcgtcgagttcaagaaagacgagttcccccgc
gccggcaccaccgtcgagggtatttccaagctgaagggcgcattccccgtgggccctgag
tcccccaatccccaggtcgtccacacctttgagcccaccggtttcaaggacgccgccgac
aagggaaccccgcgcgtcactgccgcctccgcctccggcattaacgacggcgctgccgcc
atcgttctggcctccggcgaagctgtgaagaaatacggcctgaagcccatggccaagctg
gtctcctggggccagggcgccgtcgatcccaagatcatgggcgtcggccccgttcccgct
tccaagcaagccatggccaaggccaatctgtctatcaacgacatggacttggtggaagcc
aacgaggcctttgcggcccagtccatcgccgtggcccgtgagctgaagtttgatatgagc
aaggtcaatgtcaacggcggcgctctgtctctgggtcatcccgtgggctgctccggcgca
cgcatcatcgtcactctgctccatgagatgcagaagcggcccgatgccaagaaaggtctg
gctacgctgtgcatcggcggcggccagggcgttgcaactatctacgagaagtgctga

DBGET integrated database retrieval system