KEGG   Oscillibacter valericigenes: OBV_17260
Entry
OBV_17260         CDS       T01636                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00230  Purine metabolism
ova01100  Metabolic pathways
ova01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ova00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OBV_17260 (xdhA)
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     OBV_17260 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAK98924
UniProt: G4KZU1
Position
1657180..1659474
AA seq 764 aa
MSKSVGKSVARVDAYEKATGRAKYMDDLCDQGALIAKVKHSTIAHGYVKSVDTSEAETIP
GVVKILTCFDAPDRPFPTAGHPWSMDPAHQDVADRMLLNRHVRYYGDDVAAVVAEDEVAA
MQAVRALKVEYEELPFVLDAQKAMEPDAPQIHEEYPGNVLAHTDIRKGDYQKAIQEPGLI
RVEGWYDTPTVQHCHIENHGCFAYEEAGRVVVVSSTQIPHIVRRVVGQALGIPWGQVRLI
KPYIGGGFGNKQDALYEPLCAWLCTQAGGRLVKLECSREETFVSNRVRHAIRTHIISWVR
PDGTFAARKFEAFSNQGAYASHGHGIVAKGMGAFAQLYPCDNLECDSWTVFTNRPAAGAM
RGYGIPQAMFAGECHIDDVVRALGEDPIAFRRAHLMPVGYVDGFSKNELYSDTFNQCMNK
GMAYIDFTRKFAAYRNQTGPVRRGVGCAVFWYNTAVWPISMESSSCRMVLNQDGSLQFQT
GETEIGQGCDTAYSQMVADAVGVPLEKVHVISTQDTDVTPYGTGAYASRQTYIGGFSIMQ
TGLALRERILKIAHEQTRMPVSNLDLVDGSIIRKSDGRILKTLGDLAMEALYSMDHSQHI
TAETTAQIRSNAYSFGCSFAEVEVDIPMCKVKLLNLVNVHDCGTLINPQLAEAQVHGGMS
MAIGYGLSEELKFDEKIGKPLNNNLLDYKLSTFMDHPHLEGEFVENAEPTSPYGTKALGE
PPACSGAPAIRNAILNATGVAFDRCPITPHVLYAEFRKAGLIEE
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgagcaaaagcgtcggcaaaagcgtcgcgcgcgtagacgcatacgaaaaggccacaggc
cgggcaaagtacatggacgatctgtgtgaccagggagccctgatcgcaaaggtcaagcac
agcaccatcgcccacgggtacgtgaagtccgtcgataccagcgaggcggagaccatcccc
ggagtggtgaagattctcacctgttttgacgcgcccgaccgccccttccccacggccggt
catccctggtccatggatccggcacatcaggatgtggcggaccggatgctgctgaaccgc
cacgtgcggtactacggcgacgacgtcgccgcggtggtggcggaggacgaggtggccgcc
atgcaggccgtccgggcgctgaaggtggaatatgaggagctgcccttcgtgctggatgcg
cagaaggccatggagccggacgcgccgcagattcatgaggagtatccgggcaatgtgctg
gcacacaccgatattcgcaaaggcgactaccagaaggccattcaggagccggggctcatc
cgggtggagggctggtacgacacacccacggttcagcactgccacatcgagaatcacggc
tgctttgcgtatgaagaggcgggccgggtggtggtggtctcctccacccagatcccgcat
atcgtccgccgcgtggtggggcaggcgctggggattccctggggtcaggtgcggctcatc
aagccctatatcggcgggggcttcggcaataagcaggacgcgctgtatgagccgctgtgc
gcctggctctgtactcaggcgggcgggcggcttgtgaagctggaatgctcgcgggaggag
acctttgtgtccaaccgggtccggcacgccatccgtacccacatcatctcatgggtccgg
cccgacgggacattcgcggcccggaagtttgaggcattttccaatcagggggcctacgcc
tcccacggccacggcattgtggccaagggcatgggcgcgtttgcccagctgtatccctgc
gacaatctggagtgtgacagttggaccgtgttcacaaatcggcccgccgccggggccatg
cggggctacggaattccgcaggccatgtttgccggggagtgccacatcgacgacgtggtg
agggcgctgggtgaggatcccatcgcgttccggcgggcgcatctgatgccggttggatat
gtggatgggttctccaagaacgagctgtatagcgacacgttcaaccagtgcatgaacaag
ggcatggcgtacatcgactttacgcggaagttcgcggcatatcggaaccagaccgggcca
gtgcgcaggggcgtcgggtgcgcggtgttctggtacaacacggcggtgtggcccatctcc
atggagagttcctcctgccggatggtgctgaatcaggacgggtccctgcaattccagacc
ggcgaaacggagatcggacagggctgcgataccgcctattcccagatggtggcggacgcg
gtgggcgtgccgctggaaaaggtccacgtgatctccacccaggacaccgacgtgacgcct
tacggtaccggagcctatgcctcccggcagacgtacataggcggattctccatcatgcag
accggacttgccctgcgagagcgaatcttaaagatcgcccatgagcagacccgtatgccg
gtctccaatctggatttagtggacggcagcatcattcgcaaatccgacgggcgaattttg
aaaaccttgggggacctggctatggaggctctatattccatggaccacagccagcacatc
accgccgagaccaccgcccagatccggtccaacgcctattccttcggctgctccttcgcg
gaggtggaggtggacatccctatgtgcaaggtgaagctattgaatctggtgaacgtccac
gactgcgggaccctcattaatccccagctggcagaggcgcaggttcacggcggcatgtcc
atggccatcggatacgggctttccgaggagctgaaatttgatgaaaagattggcaaacca
ctaaacaacaacctgctggactacaagctatccacatttatggaccatccccatctggag
ggggagtttgtggaaaacgcggagcccacctcgccctatggaaccaaagcgctgggcgag
ccgccggcctgctccggcgccccggctatccgcaacgcgattctcaacgccacaggggtg
gccttcgaccgctgccccattacgccccacgtgctgtacgcggagttccgcaaagcggga
ctgatcgaagagtga

DBGET integrated database retrieval system