KEGG   Oscillibacter valericigenes: OBV_19290Help
Entry
OBV_19290         CDS       T01636                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00260  Glycine, serine and threonine metabolism
ova00750  Vitamin B6 metabolism
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_19290 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OBV_19290 (thrC)
Enzymes [BR:ova01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OBV_19290 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAK99127
UniProt: G4L1B0
Position
1825327..1826814
Genome map
AA seq 495 aa AA seqDB search
MKYYSTRDTAVSLDAAQAVKQGLSRDGGLLTPTEFPKLSEMDLNAMLPMTYQQRAAVIMG
LYLPDYSAKELLAFAEKAYGPARFDTSAVAPVRTLDEATHCLELWHGPTSAFKDLALQML
PQLLSAALKKTGETRTACILAATSGDTGKAAMEGFADVEQTKILVFYPKDGVSAVQEAQM
VTQRGENVGVCSVVGNFDDTQSGVKRIFSDEALRTELDRRGYFFSSANSINWGRILPQVV
YYISTYCDLVRDEKLKMGEKINFCVPTGNFGDILAGYYAKKMGLPVGRLICASNKNDVLT
EFLTTGTYDRNRVFYNTMSPSMDILISSNLERLLFDLGGRDGEKVRDYMDQLAMSGSYRV
DDAILAQIRELFWAGSSGEEATAAAIARTYKDCGYLIDTHTAVAADVMAQYRAATGDSTP
TVFVSTASPFKFCDSVLKAIGETPKGKGVDLIDQLQYVTGRPAPWRLAALREKERRFNLS
RKKEEMPEVVRTFLK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattacagcacgcgggataccgcggtgtctctggacgcggctcaggccgtgaag
cagggactgagccgggacggcggtctgctgactcccacggagtttccaaaactctccgag
atggatttaaacgccatgctgcccatgacctatcagcagcgtgccgccgtgatcatggga
ttgtatctgccggattacagcgccaaagaactgctggccttcgcggagaaggcctacggc
cctgcccggttcgatacatccgccgtggccccggtgcggacgctggatgaagccacccac
tgtctggagctgtggcacgggcccacctccgcgtttaaggatctagcgctccagatgctg
ccccagctgctgtccgccgctctgaaaaagacgggtgagacccggacggcctgcattctg
gcggccacctccggtgataccggcaaagccgccatggagggttttgccgacgtggaacag
acgaagattctggtgttctatcccaaggacggcgtctccgccgtgcaggaggcccagatg
gttacccagcggggagagaacgtgggcgtctgctctgtggtgggaaattttgacgatacc
cagagcggcgtgaagcgcattttctccgacgaagcgctccggaccgaactggacaggcgg
ggctatttcttctcctccgccaactccatcaactggggacgcatcctgccgcaggtggtt
tattacatctccacttactgtgatctggtgcgagacgaaaaactgaagatgggggagaag
atcaacttctgcgtccccaccggcaacttcggcgatattctggcggggtactacgcaaaa
aagatgggcctgcccgtgggcaggctgatctgtgcgtccaataaaaacgacgtgctgacg
gaatttctgaccaccggaacctatgaccgcaaccgggtgttttacaataccatgagtccc
tccatggacattctgatctcctccaatctggagcggttgctgttcgatctcggcggacgg
gacggtgaaaaggtaagggactacatggaccagcttgccatgagtggcagctatcgggtg
gacgacgccattctggcgcagatcagggagttgttctgggccggctccagcggcgaggag
gccaccgccgccgccattgcccgcacttataaggactgcgggtatctcatcgacacccac
accgccgtggcggcggacgtgatggcgcagtatcgcgccgccaccggcgactccacgccc
accgtgttcgtctccaccgcgtcccccttcaagttctgcgacagtgtgctcaaagccatc
ggcgagacgccgaaggggaagggcgtcgacttgatcgaccagctccaatacgtcaccggg
cggcccgctccctggcggttggcggccctgcgggaaaaagagcgacggttcaatctttcc
cggaagaaagaagagatgccggaggttgtgcggacgttcctcaaataa

DBGET integrated database retrieval system