KEGG   Oscillibacter valericigenes: OBV_20790Help
Entry
OBV_20790         CDS       T01636                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00010  Glycolysis / Gluconeogenesis
ova00052  Galactose metabolism
ova00500  Starch and sucrose metabolism
ova00520  Amino sugar and nucleotide sugar metabolism
ova00521  Streptomycin biosynthesis
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_20790 (glk)
   00052 Galactose metabolism
    OBV_20790 (glk)
   00500 Starch and sucrose metabolism
    OBV_20790 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    OBV_20790 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OBV_20790 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    OBV_20790 (glk)
Enzymes [BR:ova01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OBV_20790 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAK99277
UniProt: G4KNW4
Position
1966134..1967075
Genome map
AA seq 313 aa AA seqDB search
MYVGIDVGGTNLKAGLVDEAGRLLATRKIPLGMFQGEEYFVRKLAELTAQVSRDGGVIPG
ELEYVGMGIPGAVAEGDILYTCNIPLQNVPIGRLFSQYLDVPVMLENDANCAAVGEYFRG
AGQGTKDFAVVTLGTGIGGGFILGGKLYAASGMAGEVGHMVVEKGGVLCNCGRRGCWEAY
ASATGLIRMTKETMERARESLLWEESKGGSAVSGRTAFAAALRGDRTAKALCETYVEYLA
AGIVNLLNILQPEVLAIGGGISEAEDELLLTPLKEIVDRESYAAHCGGKATVVKAELGND
AGMIGAALLKRAI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtaggaatcgacgtaggcggtacgaatctgaaggcgggcctcgtggacgaggcg
ggccgtcttctggcgacccgaaaaattcctctgggtatgtttcagggcgaggaatatttt
gtccgtaagctggcggagctgacggcgcaggtctcgcgggacggcggcgtgattcccgga
gagctggaatatgtgggcatgggtattcccggcgcggtggcggagggggatatcctatac
acctgcaacattccgctgcaaaacgtccccatcggcagactgttcagccagtatctggac
gttccggtgatgcttgaaaacgacgccaactgcgccgctgtgggcgagtattttcgcggc
gcgggacaggggacaaaggactttgccgtagtgactttgggcacgggcatcggcggtgga
ttcattctgggcggcaaactttacgccgccagcggcatggccggcgaagtggggcatatg
gtggtggaaaagggcggcgtactctgtaactgcgggcggcgcggctgctgggaggcatat
gcctccgccaccggactgattcgcatgacgaaggagactatggaacgggctcgggagagc
cttctctgggaagaatccaagggcgggagcgccgtttcgggccggacggcctttgccgcg
gccctgcggggagaccggacagcaaaagcgctgtgcgagacctatgttgaatatctggcg
gcgggcatcgtaaacctgctgaacattttacagccggaggtgcttgccatcggcggaggc
atcagcgaggcggaggacgaactgctgctgacgcctcttaaggagatcgtggaccgggag
agctacgccgcccactgcggcgggaaagccacggtggtcaaggcggagcttggcaacgac
gcgggcatgatcggcgcggcgctgctgaagcgggcaatctga

DBGET integrated database retrieval system