KEGG   Oscillibacter valericigenes: OBV_21370Help
Entry
OBV_21370         CDS       T01636                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00010  Glycolysis / Gluconeogenesis
ova00020  Citrate cycle (TCA cycle)
ova00620  Pyruvate metabolism
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
Module
ova_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_21370 (acoC)
   00020 Citrate cycle (TCA cycle)
    OBV_21370 (acoC)
   00620 Pyruvate metabolism
    OBV_21370 (acoC)
Enzymes [BR:ova01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OBV_21370 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: BAK99335
UniProt: G4KP22
Position
2031480..2032820
Genome map
AA seq 446 aa AA seqDB search
MATEVLMPKMGLTMTEGTIEEWKKKEGDAVKAGDVLFSVATDKLTNDVECDTDGTLLKIL
FGEGETVACKTVIAWIGASGEAIPGASAACASVPAAAPAAGTAPEAAASAAGASRAPGEY
VLATPRAKKLAKDKGYDLSRIPGTGPKGTVVAKDVESFMAGPKTSPMAAKLAAELGVDVS
NLNINGRVMKADVLTAAGKTAAAPAAEAAAEALVPGSNDEAPRKVSPLRRSIAANMTESW
HTAPRVTYTRPVEATAMKDLRAKLKDDLKAKGVKLTYNHILMMVVTRALTEFPDINSSFV
DNMLTHHPHVNIGLAVAKGDGLIVPNVKNAETKSLAEIAVETERLIADTRDGKVQMEDIT
GGTFTISSLGPYGITSFSPIINQPELGILGVCDMVDTPVVRDGQIVIRTMMNLSLTADHR
VVDGVMASKFLKRIAELLENPYMLLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaagtattgatgccgaaaatgggtctgactatgaccgaaggcaccattgaa
gagtggaaaaagaaggagggcgacgcggtcaaggcgggcgacgtgctgttctccgtggct
accgataaactgaccaacgacgtggagtgcgacaccgacggaaccctcctgaaaatcctc
tttggcgagggagagaccgttgcctgcaagaccgttattgcttggatcggcgcctccggc
gaagcgattcccggcgcttctgccgcttgtgcatccgttcccgccgcagccccggccgcc
gggactgctccggaggccgctgcatccgccgctggtgcgagccgcgcgcccggcgagtat
gttctggccaccccccgtgccaagaagctggcaaaggacaagggctatgacctttcacgg
attcccgggacaggacccaagggcaccgtggtggcgaaggacgtggagtccttcatggcc
ggtcccaagaccagccccatggccgcaaagctggccgccgagctgggcgtggatgtgagc
aacctgaacatcaatggccgggtgatgaaggccgacgtgctgactgccgccggaaagact
gcggctgctcccgcagcagaagccgccgcggaagcgctcgttccgggcagcaacgacgaa
gcgcccaggaaggtaagcccgctgcgccgcagtatcgccgccaacatgacagaatcctgg
cacaccgctccccgtgttacctacacgcgcccggtggaagcaacggccatgaaagacctg
cgcgccaaactgaaggacgacctgaaggcaaaaggcgtcaagctgacctacaaccacatc
ctgatgatggtcgtcaccagggctctgacggagttccctgatatcaactccagcttcgtg
gacaacatgctgacccatcatccccatgtcaacatcggcctggcagtggccaagggagac
ggcctgatcgttcccaacgtgaaaaatgccgagaccaagtctctggcggagatcgccgtc
gagacggagagactgatcgcggatacccgtgacggcaaggttcagatggaggacatcacc
ggcggaacgtttaccatttcctctctcggtccctatggaatcaccagcttctcccccatc
atcaatcagcctgagctggggattctgggtgtttgtgatatggtggataccccggtggtc
cgcgacggccaaattgtcatccgcaccatgatgaacctgtccctgactgccgaccaccgc
gtggtggatggcgtcatggcctccaagttcctcaagcgcatcgccgagctgctggaaaat
ccgtatatgctgctggtctga

DBGET integrated database retrieval system