KEGG   Oscillibacter valericigenes: OBV_26520Help
Entry
OBV_26520         CDS       T01636                                 

Definition
(GenBank) Na(+)-transporting decarboxylase carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00620  Pyruvate metabolism
ova01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ova00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OBV_26520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ova02000]
    OBV_26520
Enzymes [BR:ova01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     OBV_26520
Transporters [BR:ova02000]
 Other transporters
  Primary active transporters [TC:3]
   OBV_26520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like AroM
Motif
Other DBs
NCBI-ProteinID: BAK99850
UniProt: G4KR27
Position
2503582..2504943
Genome map
AA seq 453 aa AA seqDB search
MKFLSGKPLLITDTTLRDAHQSQAATRMRLRDMLPACELLDSIGFYSLECWGGATFDACM
RYLDEDPWERLRALRRHLPHTRLQMLFRGQSILGYRNYADDVVDSFCAKSIENGIDIVRV
FDALNDVRNLEQAVRSVKKYGGLAEAAVSYTVSPIHDEAYFVRLAQELAQMGADSICVKD
MANLLSPVAAYSLIKRLKETVALPIHLHTHDSAGTGSMVNLMAAFAGADIVDTALSPLAG
GTSQPATESMVSALRDTPRDTGLDLTRLGAAAAHFRTVANSLEEEGFLDPRVLRVDANAL
LWQVPGGMLSNLIAQLRQMGREDLYETVLAEIPNVRRDFGYPPLVTPSSQIIGSQAVLNV
ITGKRYQMFSRESKAMLKGEYGRLPGEVNPEVLQKAGIREADRITCRPADLLKPELPENR
EKYGNLAQSEEDVLSLTLFPQVAEEFLSKRQKT
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctgagcggtaagcctcttctcattacggatacgaccttgcgggacgctcat
cagtctcaggccgccacacggatgcggctccgggatatgctgcccgcctgtgaacttctg
gactcaatcgggttttactcgctggaatgctggggcggtgcaacctttgacgcatgtatg
cgctatctggacgaggacccgtgggaacgactccgcgcactgcgccgtcatctgccccac
acaaggctgcaaatgctgttccgggggcagagcattttgggctaccggaactacgccgac
gacgtggtggactctttctgcgcaaaatccatagaaaacggtatcgacatcgtccgggtt
tttgatgctctgaacgacgtacggaatctggaacaggctgtccgctccgtgaaaaaatac
ggcgggcttgcggaagccgccgtctcttacacggtctcccccatccacgacgaggcgtat
ttcgtccgcctggcccaggagctcgcgcagatgggcgcagactccatctgcgtcaaggac
atggcgaacctgctgtcccccgtggccgcctattccctgataaaacgactgaaggagacc
gtcgctcttcccatacacctgcacacccatgattccgcagggaccggctccatggtaaat
ctgatggcggcattcgccggagcggacatcgtagacaccgccctgtcccctctggcgggc
ggaacctcccaacccgccacagagtccatggtttccgcgctgcgggatacaccccgggat
accggactggacctcacccgtctgggcgcggcggcggcgcacttccgaaccgtggcaaat
tctctggaggaggagggttttctggacccccgcgtccttcgggtggacgccaacgccctg
ctctggcaggttcccggcgggatgctgtccaatctcatcgcccagcttcgccaaatgggg
cgggaggacctgtatgaaacggttctggcggaaattccaaacgtccgccgggatttcggt
tatcctccgctggtgactccctccagtcagattatcggctctcaggccgttttgaatgtc
atcacggggaagcgctaccagatgttctccagggaatccaaagccatgctgaagggggaa
tacggaagacttcccggcgaggtcaatccggaggttctgcaaaaagccggcatccgggag
gcggaccgcatcacctgccgtccggccgaccttcttaagccagagctgcctgaaaatcgg
gaaaaatacgggaatctggcccagagcgaggaggatgtactctccctgactctgtttcct
caggtggcggaggaatttctttccaagcggcaaaaaacgtga

DBGET integrated database retrieval system