KEGG   Opisthorchis viverrini: T265_00465Help
Entry
T265_00465        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ovi04121]
    T265_00465
Ubiquitin system [BR:ovi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     T265_00465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank SOCS_box
Motif
Other DBs
NCBI-GeneID: 20314653
NCBI-ProteinID: XP_009162502
UniProt: A0A075AJQ6
Position
Unknown
AA seq 270 aa AA seqDB search
MCALPCNPLMLPSVRILETGTNQELRNLVKEVDLVRVRDADNNTLLHHACLLGNVEAVRL
LLDAGLHPNVGNVDGHTALCDAALNGSTEVISLLLNHGVDVNPSSYWGSPLMYATKNGHI
DAMRLLIKAGAAVNAPDRSGFCPLHIAVRKKFYAGVQLLLMGDADPNCPARLTTPLHLAA
EMNDLHGASLLLAHGAYPNPIDKFNRTPLDYVPRDTDLYRLLNTRTSQVPSLQFLVRLAF
RKTIQAAGPDQLSKLRLPSLLYDYLTFNRL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcacttccttgcaatccattaatgctgccatcggtgaggatactggagaccggc
accaaccaagaattacgcaaccttgtcaaggaagttgacttggtgcgtgttagagatgcg
gacaacaacacgttgttacatcacgcttgcttgctgggcaatgttgaagccgtacggttg
ctgttagatgcaggattacacccgaatgtgggaaatgtcgatggccacacagctttgtgt
gatgcggctttgaatggatcaacggaggtcatttcccttcttctcaatcacggcgttgat
gttaacccttcttcctactggggatcacctttaatgtatgccaccaaaaacgggcatatt
gatgccatgcgactgctaataaaagcgggagctgcagtcaatgcaccggatcggtctgga
ttttgtcctctgcacattgcagtccgaaaaaagttttatgccggagtccaattactcctg
atgggagacgctgatcccaactgtccggctcgcctgactacccccctccatctggccgcc
gaaatgaatgaccttcacggggcttcgcttttgcttgctcatggagcttatccgaacccg
attgataagttcaatcgcactccactagactatgttcccagggataccgatctgtatcga
ctgctgaacaccaggacttctcaagtgccctcactccaattcctcgtccgcctggctttc
cgaaaaacaatccaggctgcggggcctgatcaactgtccaaactgcggttgccgtccttg
ctttatgattacctgacttttaaccgtttgtga

DBGET integrated database retrieval system