KEGG   Opisthorchis viverrini: T265_01164Help
Entry
T265_01164        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ovi04131]
    T265_01164
Enzymes [BR:ovi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     T265_01164
Membrane trafficking [BR:ovi04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    T265_01164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC MctB
Motif
Other DBs
NCBI-GeneID: 20315352
NCBI-ProteinID: XP_009163389
UniProt: A0A074ZZI7
Position
Unknown
AA seq 448 aa AA seqDB search
MNPTCASRLPLSRLGQPGSIAALVQPSGFIRDRLCSPIWIPLKGSFPGTIQTSEDLSKDQ
PVMVPSERLQGKEISSIRIEIGWQATHSPDWESLIRLVGVNAHKSPVHRSRILVFVGLVF
FTVVVLEQAVSQPNLMRLDGSYPSSGEVVSWKRAHEECYFTLNLGRAIAAPIIGLLSVYR
CSVMHPTIELADLVVNNGMRLYSPRILPKIYMVGFRIFLVQFHLTALETVTFIDMDSDDG
RVDYLERLVVQKSLPITMHNKRGTVPFCDICFLIKPDRTHHCSTCEKCIPKMDHHCPWIN
NCVGFHNQKYFVLFLFYAICYCLLCSLASFPFVRLLIQGQLDLSTGGMHAFFLFIIALVF
ALAVGILLGFQMILVMKNKLTLEFHRPPIFRDASRRDSFDLGVKQNMAQVFGNEWRLWCF
PLFSSLGTGFTFPMRSSLQHSDREPLLA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgacctgcgcctctcgacttcccctgtctaggcttgggcaacctggcagtatc
gcagccctcgtgcaaccttcgggttttataagagatcgcctctgctcacctatttggata
cctctaaagggatcttttccaggaacgattcaaacctccgaagatctctcaaaggatcaa
cctgtgatggtcccatctgaaaggttacagggcaaggagatttcatccatacgaattgaa
atcggatggcaggcgacccacagccctgattgggagagtttgattcgtttggttggcgtg
aatgcacataagagcccagtgcaccggtctcggattctggtctttgttggattggtattt
ttcaccgtggtggtactggaacaggcagtctctcagccaaacctcatgagactggacggg
agttatcctagttcgggagaggttgtctcttggaaacgagctcatgaggagtgctacttt
actttgaatttgggtcgtgccattgctgctcccataattggtttactgtctgtctaccgg
tgttcagttatgcatccgactattgaactggcagatttggttgtgaacaatggtatgcgt
ctttattcgccacgtattctcccaaagatttatatggtcggattccgaatatttcttgtt
caatttcatttgaccgcattggaaactgtcacattcattgacatggacagtgatgacgga
cgtgttgactacttagaacgactggttgtccagaaatccttaccgatcaccatgcataac
aagcgggggactgttcccttttgtgatatttgctttctcattaaaccagaccgtactcac
cattgttccacatgtgagaaatgcattcctaaaatggatcaccattgcccatggatcaac
aattgtgtgggctttcacaatcagaagtactttgtcctctttctgttctatgcgatctgc
tactgtctgctatgctcactggctagttttcctttcgttcgacttttgatccagggacaa
ttggacctcagcactggtgggatgcatgctttctttctatttattatcgccttggttttt
gctctcgccgtgggcatcttgttggggttccagatgatacttgtgatgaagaataaactc
actctggaatttcaccgacctcccatttttcgtgatgctagtcggagggactcgttcgat
ttgggtgtgaaacagaatatggcgcaagtgtttggaaatgaatggaggctatggtgtttc
ccgctattctcaagcttgggaacaggattcaccttcccgatgcgctccagtctgcaacat
tccgatcgggagccactgttagcctga

DBGET integrated database retrieval system