KEGG   Opisthorchis viverrini: T265_01251Help
Entry
T265_01251        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ovi  Opisthorchis viverrini
Pathway
ovi03040  Spliceosome
ovi04141  Protein processing in endoplasmic reticulum
ovi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    T265_01251
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    T265_01251
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    T265_01251
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ovi01009]
    T265_01251
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ovi03041]
    T265_01251
   03009 Ribosome biogenesis [BR:ovi03009]
    T265_01251
   03110 Chaperones and folding catalysts [BR:ovi03110]
    T265_01251
   04131 Membrane trafficking [BR:ovi04131]
    T265_01251
   03051 Proteasome [BR:ovi03051]
    T265_01251
   03029 Mitochondrial biogenesis [BR:ovi03029]
    T265_01251
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovi04147]
    T265_01251
Protein phosphatases and associated proteins [BR:ovi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     T265_01251
Spliceosome [BR:ovi03041]
 Complex B
  Other components
   Prp19 complex
    T265_01251
 Complex C
   Prp19-CDC5 complex
    T265_01251
Ribosome biogenesis [BR:ovi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    T265_01251
Chaperones and folding catalysts [BR:ovi03110]
 Heat shock proteins
  HSP70 / DNAK
   T265_01251
Membrane trafficking [BR:ovi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    T265_01251
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    T265_01251
Proteasome [BR:ovi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    T265_01251
Mitochondrial biogenesis [BR:ovi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    T265_01251
Exosome [BR:ovi04147]
 Exosomal proteins
  Proteins found in most exosomes
   T265_01251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 20315439
NCBI-ProteinID: XP_009163500
UniProt: A0A074ZZ99
Position
Unknown
AA seq 540 aa AA seqDB search
MPVIGIDIGTSYSCVGTVVDGQVRLFPTEKGNNLLPSIVAFDQGRCLVGEAAKSKLTESP
ENVIYDIARIIGRSRADKHLTLDEKKWPFCISEHQGRVGVNVTHKNQPTTFTAEEILAIL
LMHLKQMAQTALRKPVGEAVICIPAHFNNQQRLATTSAARIAGLKVTQLISAPAAAAIAY
RREMNIYKEQKLLVLVMGGGTCDVSVITTKDDIIQVDATAGDCHLGGTDLDANLADYLVD
QFRTKYGKDFSANHVAVQRLRLACETAKRTLSVSARAHVSIPDIHENLRLSARLTRTEFE
SMNADIFNKILNLVELVVEDAMITKNSIDDIVLVGGSSWIPKVQEVLTTFFDGKPLNRIL
SPQEAVCTGVAIYANHSKQHNGTSSSENSMNATNHMLTEVSPFSLGIEVKGGRMNYIIRR
NTPIPIRDFKRYTTTVDEQDSLSIVIFEGENTSVAKNTCLGKFHLTGFSAAPAGVPNIKV
VFDVDANGILNVKAYDETARQNVPLPITCDSTQLTPDDIVQLAKQMERLWEENGPQPENH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcattggaatcgatataggaacaagttactcctgtgtcggaacggtagtcgac
ggtcaggtgcgcctatttcctaccgaaaaaggaaacaatttacttcccagtattgtggca
tttgatcaaggccgatgtctagttggtgaagcagcaaagtcaaaactgacagaaagccca
gaaaatgtcatctacgacattgcaagaataattggaaggtcaagagcggataagcatttg
acgttggatgaaaagaagtggcctttctgtatttccgaacatcagggtcgtgttggagta
aatgtaacgcacaaaaatcaaccaaccacttttactgcagaggagattttggccattctt
ttgatgcatctgaaacaaatggcacaaactgctttaaggaaaccagtgggtgaagctgtc
atttgtattccggcgcatttcaataaccaacaacgactggcaacaacaagtgcagctcgg
attgcagggctgaaggtcacgcagctcattagtgcgccagctgctgccgctattgcttac
aggagagaaatgaacatttacaaagaacaaaaacttctcgttcttgtaatgggtggagga
acgtgtgatgtgtctgtaatcaccaccaaggacgacatcatacaagtggatgcgacagca
ggtgattgtcacctcggtgggacagatttggacgccaacttggctgattatcttgtcgac
cagtttcggacaaaatatgggaaggattttagcgcaaaccatgtagcagtacaacgtttg
cgacttgcgtgtgaaacggcaaagcgtacgttgagtgttagtgccagggcacatgttagt
attccagatattcatgaaaacctgagactttcagcccgattgacccggaccgagtttgaa
tccatgaacgcggatatatttaacaagattctgaacctggttgaattagtagtggaagac
gcaatgattacgaagaatagcattgatgatattgtgctggttggtggctcttcctggatt
cccaaggtgcaagaggttttaaccacattctttgatggtaagccgttgaaccggatcctg
agtccccaagaagctgtgtgtacaggagtagctatctatgcaaatcactcaaaacaacac
aatggaacttcgtcttctgaaaattcgatgaatgctaccaaccacatgttaactgaagtt
agtcctttttctcttggaatcgaagtaaaaggtgggcgaatgaattacatcattcgtcgg
aacacaccgattcctatacgtgatttcaaaaggtacacaaccaccgtcgacgaacaggat
agtctttctattgtgatatttgagggcgaaaatacaagcgtggccaaaaacacatgcctt
ggaaagttccatttaactggattttctgcagcaccagccggggtgcccaatatcaaagta
gtgtttgacgtggatgccaatggaattttgaatgtgaaggcatatgatgagaccgctcgg
caaaatgtgccattaccaataacttgtgactccacccagttgactccggatgacattgtc
caactggccaaacaaatggaacgtttgtgggaagagaacgggcctcagcctgagaatcat
tga

DBGET integrated database retrieval system