KEGG   Opisthorchis viverrini: T265_01827Help
Entry
T265_01827        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00010  Glycolysis / Gluconeogenesis
ovi00562  Inositol phosphate metabolism
ovi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T265_01827
   00562 Inositol phosphate metabolism
    T265_01827
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     T265_01827
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     T265_01827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 20316015
NCBI-ProteinID: XP_009164201
UniProt: A0A075AIQ6
Position
Unknown
AA seq 439 aa AA seqDB search
MHDPSSRNGKQLTASFPYIFLTINPIAYCFSLLMGLLTKIKLFIAFLIGIKSGTILDSLE
DKKLDLSAFSTKTAYRYCGLTPFNDGTLQKLDSCKPIHINGIYRHGTRAPSLKDVQRVRD
LRAKLLSSENVMLPSGFRDYPVPFANETDRGLLPRGLEELHSLGQRIRNRMPPWFESTDG
IKFYTSSSSRAILSARSFYHGLFNLTPLDAQNTWDAELHLNALPETIQIADRFTRLFESC
KRYATEIGKNKSALEEHFKFIDGAEMKEAFKEIMSRNRLPASKFSTGDIYIMFRICGYEI
AVFSNDQSPWCGFLRKNYQPILEYILDLKSSSAVHIRWLCRDLDPGQLTCGAGVLRLLQR
TLDASEFSHLNRRTCSRLSEVTGMAEQSNDDPVTGFDDRLTRQSGLPSQVGSYRKCPYAV
SRKKQLRIAVYIVLSTKQS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatccatcaagtcgcaacggaaaacagttaacagcaagtttcccttacatcttc
ctgacgatcaatcctattgcttattgtttcagcttgctgatgggactgttaacgaagatc
aagttgtttattgcttttcttatcggcatcaaaagtggcacgatattagattcactggaa
gacaaaaagcttgacttatctgcattttccaccaaaacggcctaccgctattgtggactt
actccgttcaatgatggaacccttcagaaacttgattcttgcaagcccattcacattaat
ggtatatacagacacgggactcgtgccccgtcgctaaaggatgtgcaaagggtacgagac
cttcgtgctaaactcctttccagcgaaaatgtgatgttaccttccggattccgtgattat
ccagttcctttcgcaaatgaaactgatagaggcttgttaccacgaggattggaggagctg
cacagtttgggtcagcgtattcgcaacagaatgcctccttggttcgaatcgactgacggc
atcaaattctacaccagttcgtcatcaagggcaattctcagtgcacgttcgttttaccac
ggtctattcaacctcacaccactggatgctcaaaatacttgggatgctgaacttcacttg
aatgcacttcctgagactattcaaattgcagatagatttacccgattatttgaatcttgt
aaaagatatgcgacggaaattgggaaaaataagtcggcacttgaggagcattttaaattc
atcgatggtgcagaaatgaaagaagcgttcaaggaaatcatgtcaagaaatcggttacca
gcatcgaaattttcaacaggtgacatatacatcatgtttcgcatatgcggttatgaaatt
gccgtgttttccaacgaccagtcaccttggtgtggtttcctacgtaaaaactatcaaccc
atcctggaatatattctggatctaaagagctcatcagcagtgcatatccgatggttgtgc
cgggatttggaccctggacaactgacatgcggtgcaggcgtgttacggctactccaacgc
acgttggatgcatctgaattttcacatctgaacaggcgaacgtgttcacgcttgagcgaa
gtgactggtatggccgagcaatcaaacgacgacccagtaactggttttgatgatcgatta
acccgccagtcaggactccccagtcaggtagggtcatacagaaaatgcccatatgctgtc
tccagaaagaaacagctcaggattgccgtatatatcgtactttccacaaaacagagctaa

DBGET integrated database retrieval system