KEGG   Opisthorchis viverrini: T265_02367
Entry
T265_02367        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00230  Purine metabolism
ovi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    T265_02367
Enzymes [BR:ovi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     T265_02367
SSDB
Motif
Pfam: Guanylate_cyc DUF2104
Other DBs
NCBI-GeneID: 20316555
NCBI-ProteinID: XP_009164845
UniProt: A0A075A722
Position
Unknown
AA seq 1119 aa
MQRHLGWLARSRVFHLSLRRNSVQPTESYTLVDKLGQIYRDISSILSFHSKVYENYFNAA
SIQYTRRCFRSALIFALFTYWGCIFAAAYNTGAFEEHIMKLFLVLMVAALLLYLFSYNKY
SHQWYSRTSCAVLAVAFSISMIGSMEVIVKWISIIPYLEMLFSLCIILPLTLDFTLSLIV
SFSFAYMNAAEHQITFTTCGNETYSYGTNLTDDQSRTLSFYCGIRHGVTIEFALCVLIFI
TGMYLQFWNTIRRRAAFIYIGQAVHLQRRNRKVLATNESLRDVLMPSFIWHKYEGKENLR
QTYANRRLYLQSAVDVTILVTELVNFRELISTQDIQTVVLIMSDMIDYFDRKSNEYDCER
LAVLPDTYVYTCGVVKSRMNHARCCVELARAMVHVNEHLTLERSHLVLLRVGIHTGKVTI
MVWGGRKVHYDLISPDVFIAFHVKDSGPPGYITISDDTHTRVHMNFPTELGERLILQTEC
LVDGKFTVRSKALQTYYVTQEPTEMEGSITSSVKSEHGLFERCVHLLGQIRASKSRKPTL
LNQDFASEAFAAATTVGRRSVFCVSPKESAIPNTSIHCNGEISRWNKDRTEELDSGKPYQ
LDAEVLRLITQLRADPKRQITLMQYIPVGTWSNVFTNRELEWHYVNHVQDPNNPIYIDSL
KLAPAMDAIMILVTTVTLLVCSMTFTGYERSDRRIFILYALEVFVALLLCVCVCWTSTRF
VQSVTAGVGRRLFVIMSRNSTRQFFVFVLTILPSIHSFIFFSLLEVNVVGELRSNNALIV
FNTISILNIMVATTNSKWIGILSLFICHFGYLYTYGTIIEPKRFSPSTWGSINSLLMAEE
LMSDQLIRVCTSFIVVLTMINLNERNCRLNFIAMRELQISREESEIYHTRLREMMNHLLP
SYVKRQLLRSRFSIPNSSVKHHNAEWENVGVAVLYMSNLYITHWNLESAQWELSLKVLNL
FVCTIDDMISSGRFTELEKVRFFNDMIVLASGLNQFTTWDCSDTTHMDILVEFCVQAQRR
MQRINSEHLSKKRMIDLKIGYTRGQVTTAVIGLRKPTFVAWGRSLEVAENVARNAFAHEV
QTVFECTLILSAQYEAILAGVIPVENEGLLDTYIVRPHR
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcaacgtcatctcggttggctagcacgtagcagagtgtttcatcttagcctgcggaga
aactcggtccaaccaacggaatcgtatacactggtggataaacttggtcagatataccga
gacataagctccatcttatcctttcactcgaaagtgtacgaaaattatttcaatgcggct
tctattcagtacacaaggcgatgcttccgctcggcactcattttcgctctcttcacctat
tggggctgcatatttgctgcggcctacaacactggtgcgtttgaagagcacatcatgaag
ctatttctggttctgatggtagcagcgttgctcctttatcttttttcttataacaaatac
agccatcaatggtactcacgcacttcatgtgccgttctagccgtggcgttctccatatcc
atgatcggctctatggaagtaatagtcaagtggatttctatcataccgtatttagaaatg
ctgttcagtttgtgtattatattacctttaacgctcgattttacgctgtctttgattgtg
tcgttttcttttgcctacatgaatgcggcggaacatcagattactttcaccacctgtggc
aatgaaacttattcgtatgggactaacctaaccgatgatcaatcgcgcaccctgagtttt
tactgtggcatcaggcatggtgttacaattgagtttgctttgtgcgttctgatcttcatt
acaggtatgtacctgcagttttggaatacaataagacgaagagctgctttcatctacatt
ggacaggccgtgcacctgcaacgacgaaaccgaaaagttttagcgacaaacgaaagtctg
agggatgttcttatgccttcatttatctggcacaagtacgaaggcaaagaaaaccttcgt
caaacctatgcaaacagaagactttacctccagtcagcagtggatgtaacaattctcgtc
actgaactagtcaatttccgtgaactgatttcaactcaagacatacagacagttgtactg
atcatgtcagatatgatagactactttgatcggaaatcgaacgaatacgactgtgagcgc
ttggctgttcttcctgacacctatgtatatacttgtggtgttgttaaatcacgaatgaat
cacgcaagatgttgtgtggaactggcccgtgctatggtgcatgtaaatgaacacctgacc
ttagaacgtagtcacttggttcttttacgagtcggaatccacacagggaaggttacgatt
atggtttggggaggcagaaaagttcattatgacttgatttctccagatgtcttcattgcg
tttcacgtcaaagattctggtcctccaggttacataacgatttcggatgacactcacaca
cgagtacacatgaactttccgacagaattaggcgagaggctaatcttacaaactgaatgt
ttagttgatgggaagttcaccgtacgttctaaggcgctacaaacgtattacgtaacgcag
gagcctactgaaatggaaggttcaattacttcctctgtcaagtcggaacatggtcttttt
gagcgttgtgtacacctgctgggccaaattcgtgcgagtaaatcaagaaaaccgacactc
ctcaatcaagacttcgcaagtgaggcatttgctgcggcaacaacagtcggacgtcgcagc
gtattttgtgtctctccaaaggaatcggccatcccgaacacctctattcattgtaatgga
gaaatatctcgttggaacaaagatcgaactgaagaattagacagcggcaaaccctatcaa
ctcgacgcagaggttctgcgtttgatcactcagcttcgtgcggacccaaagcggcaaatc
acattgatgcagtatattccagtaggcacctggtcaaacgtttttacaaatcgagaacta
gagtggcattatgtaaaccatgttcaagacccgaacaatcctatctatattgactcgcta
aaactggcacccgctatggacgccataatgatcctggtgacaacggtcactttactggtc
tgttcgatgacctttactgggtacgaaaggagcgacagacgtattttcatcttgtatgca
ttggaagtgttcgttgcactccttctgtgtgtatgtgtctgctggacgagcacaagattt
gtacagtctgtgaccgcaggtgtgggacgtcgtctatttgtcatcatgtccagaaattcc
acgaggcaattttttgtcttcgttctaactatcctaccaagcatacattcatttatcttc
ttttcgctgcttgaggtaaacgttgttggagagttacgctcgaacaacgcactcattgtt
tttaacaccatttcgatcctcaacataatggttgctacaactaattcaaaatggataggt
attctaagtttgtttatttgtcatttcggttacttgtacacctatggcactataattgag
ccaaaacggttcagtccatccacttggggcagtatcaacagcttattaatggcagaagaa
ttgatgagtgaccagctgattagagtttgtacatccttcattgtggtcttgacgatgatt
aacctgaacgagagaaattgtcgcctgaacttcattgcaatgcgcgagctgcagatctct
cgtgaggagtcggaaatctaccataccagattacgagagatgatgaatcatttactgccg
agctatgttaaacggcagctcctacgttcacgttttagtatcccaaattcttctgtcaaa
caccacaatgcagaatgggaaaacgttggagttgctgttctctatatgtcgaatttgtac
atcacacactggaatttagaatccgctcaatgggagctgagtttgaaggtcctgaacttg
tttgtgtgtaccattgacgatatgatttctagtggaaggtttactgagcttgagaaagtg
cgctttttcaatgatatgatcgtactggccagcggactgaaccagtttacgacctgggat
tgttccgatacaacacacatggatatactcgttgaattctgcgttcaagcccagcgtcga
atgcaacggatcaatagtgaacacctgtcaaagaaacgaatgattgatttgaagattggc
tacacaagagggcaggttacgacggcagtaatcggtctgcggaaaccaacgttcgttgct
tggggaagatctcttgaagtggcagaaaacgtcgctcgtaatgcctttgcgcacgaagta
caaacagtttttgaatgcaccttgatcttgtccgcgcagtatgaggctattttggccgga
gtgatacctgttgaaaacgagggtcttctcgacacttatattgttcgaccgcaccggtag

DBGET integrated database retrieval system