KEGG   Opisthorchis viverrini: T265_03095Help
Entry
T265_03095        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovi01001]
    T265_03095
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ovi04131]
    T265_03095
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ovi04812]
    T265_03095
   04147 Exosome [BR:ovi04147]
    T265_03095
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     T265_03095
Protein kinases [BR:ovi01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   T265_03095
Membrane trafficking [BR:ovi04131]
 Others
  Actin-binding proteins
   Others
    T265_03095
Cytoskeleton proteins [BR:ovi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     T265_03095
Exosome [BR:ovi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T265_03095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N Tissue_fac SusE C2-set_2 BiPBP_C Pkinase PilX
Motif
Other DBs
NCBI-GeneID: 20317282
NCBI-ProteinID: XP_009165764
UniProt: A0A074ZTN8
Position
Unknown
AA seq 10941 aa AA seqDB search
MKPTDATRWQDVSADFTITETHCTLPSKGLKEFTSYEFRVTAENKAGKSKPSGPSNPVEL
GIPLEFIRPLTDVALTEATEQPVVVECELSRTPQGKVQWLKDGKPLSRLPDRVRIEEDSN
GTVHRLVFHPLTEEDLGVYTIKADKISSEARVDMKIAPVLKLSEKFTDKIILKAGASTVI
EVPFAASPKPTVQWTWKPRLRPDAEPGAPQAPRFKPDVVSGMTSLPLGKVKREDAGDYEV
VIKNELGEVSVTVQLIVLDKPSAPRQPDVSENTGERGVFHWIDPEFLGISPDVAPTEGIT
YIVEMREANQRAGKPVTTTKELSTPIDGLQLNKSYIFSVAAKNEVGQSDFVDSKPVSTKL
EYGPPPSPVNLKATVNPEKAPADQQTIELTWEQPTDQATSAGPVTNYYLEMKPTDATRWQ
DVSADFTITETHCTLPSKGLKEFTSYEFRVTAENKAGKSKPSEPSNPVELGIPLEFVRPL
NDVTVTEVTEKPVVIECEFSRAPREKVLWLKDGKPLGRAPERVRVEEDADSTVHRLVFQP
LQDEDLGTYAIKVEKLVSEANVGMRVAPTLKLSEKFTDKIVLKAGASTVIEVPFAASPKP
TVQWTWKPRVRPDAEPGAPQAPRFKPDVVSGMTSLPLGKVKREDAGDYEVVIKNELGEVS
VTVQLIVLDKPSAPRQPDVSENTGERVVFHWIEPEFLGISPDVAPTEGITYVVEMREATQ
RVGKPVTTTKELSTPIDGLQLNKSYIFSVAAKNEVGQSEFVDSKPVSTKLDYGPPPSPIN
VRAVASPEKAPIDQQSVDVTWEQPTDQATSAGPVTNYYLEMKPTDATRWQDVSADFTITE
THCTLPSKGLKEFTSYEFRVTAENKAGKSKPSEPSNPVELDLPPLFGKAASFVPSGVPLE
FVRPLSDVLLTKVSDGPVILECELSRAPRDKVHWLKEGKPLGRLPDRIRVEDDANGTIQR
LAFQSLQDDDLGVYTIKVEKLSSEARLDMKATSAGPVTNYYLEMKPTDATRWQDVSADFT
ITETHCTLPSKGLKEFTSYEFRVTAENKAGKSKPSEPSNPVELDLPPLFGKAASFVPSGV
PLEFVRPLSDVLLTKVSDGPVILECELSRAPRDKVHWLKEGKPLGRLPDRIRVEDDANGT
IQRLAFQSLQDDDLGVYTIKVEKLSSEARLDMKVAPTLKLSEKFTDKIILKAGASTVIEV
PFAASPKPTVQWTWKPRVRPDAEPGAPQAPRFKPDVVSGMTSLPLGKVKREDAGDYEVVI
KNELGEVSVTVQLIVLDKPSAPRQPDVSENTGERVVFHWIEPEFLGISPDVAPTEGITYV
VEMREATQRVGKPVTTTKELSTPIDGLQLNKSYIFSVAAKNEVGQSEFVDSKPVSTKLDY
GPPPSPINVRAVASPEKAPIDQQSVDVTWEQPTDQATSAGPVTNYYLEMKPTDATRWQDV
SADFTITETHCTLPSKGLKEFTSYEFRVTAENKAGKSKPSEPSNPVELGELCFQFTMSKW
TVRPVYLFSSSRSHLGMSYYTNFLAHLGIPLEFIRPLNDFVLTEPTGEPIVLECELSRAP
KEKVQWLKDGKPLLRLPPHVRVEQDKKGAVHRLVFQLLQDEDLGMYSIKADHLTSEARVD
MKAQIFSDSQLYLIDLHNYTPEPLPYTVAPVLKLSEKFTDKIILKAGASTVIEVPFAASP
KPTVQWTWKPRLRPDAEPGAPQAPRFKPDVVSGMTSLPLGKVKREDVAPTLKLSEKFTDK
IILKAGASTVIEVPFAASPKPTVQWTWKPRLRPDAEPGAPQASRFKPDVVSGMTSLPLGK
VKREDAGDYEVVIKNELGEVSVTVQLIVLDKPSAPRQPDVSENTGERVVFHWIEPEFLGI
SPDVAPTEGITYVVEMREATQRVGKPVTTTKELSTPIDGLQLNKSYVFSVAAKNEVGQSD
FVDSKPVSTKLEYGPPATPIKVRATVNPEKAPITEQSIDLTWDEPTDQPSGAGPVTNYYI
EMKPTDSNRWLDVTADFTITEPHCTLPSKGMKEFASYEFRVTAENKAGKSKPSEPSNAVE
LGIPLEFVRPLNEIALTELTNEPVVLECQLSRAPKEKVQWLKDGKPLSRLPARVRVEEDE
KGTVHRLVFQPLEDEDLGTYTIKAEKLSSEGRVDMKLAPTLKLSEKFTDKLILKAGASAV
LEIPFAASPKPTVQWSWKPRLRPDAEPGATQTPRFTPDIVSGMTSLPLGKVKREDAGDYV
VVIKNELGEVSVTVQLIVLDKPSPPRQPEVTENTGERVVFQWLEPEFLGLSPDVSPTDAV
TYVVEMRESTQRVGKPVTTTKKLQTSIEGLQLNKSYIFSVAAKNEVGQSDFADSKPVSTT
LDYGPPSSPKNVKAVVNPAKAPVSDQTIDLTWDEPSDKAVGPVTNYTLELKPTDSTRWQD
VSGEFTITEPHCTLPSKGMKEFISYEFRVTAENKAGKSKPSEPSNPVELGHVIPRMFSCY
PSLFIHRFSSYEFRVTAENKAGKSKPSEPSNPVELGIPLEFIRPLTDVSVTELTGEPIIL
ECELSRAPREKVQWLKDGKPLGRLPDRVSLEEGSKGTVHRLVFQQLHDEDLGVYTIQAEK
LSSEGRIDMKLAPTLKLSEKFTDKIILKAGASTVIEVPFAASPKPTVQWTWKPRVRPDAE
PGAPQAPRFKPDVVSGMTSLPLGKVKREDAGDYEVVIKNELGEVSVTVQLIVLDKPSAPR
QPDVSENTGERVVFHWIEPEFLGISPDVAPTEGITYVVEMREATQRVGKPVTTTKELSTP
IDGLQLNKSYIFSVAAKNEVGKSDFVDTKPISTKLDYGPPSPPTNVCAAVSPENISIKQQ
QINVSWTPDETQPSATPVLYYIVEMRAVGDRSWSSPGLNSDKVEGLNFVVDCSRLKEEQP
YEFQVTGVNKAGKSQPSNPSNPVVLGCPLKFIRPLQDVIIQEYTGQPVVLECEVSREPRE
PVTWSRDRKPLLVRAKADDYRIESDKQDTVHRIVLPFLTEEFMGTYKIDVEKLSSEANVE
FKISPTLRLSETFSDKLILKVGASSTIEIPFVAVPKPTVEWTCTLISAKRGDQKPRFRDE
TNMSMTRLNLNKVQMEDAGDYRVVIRNRLGEVTAKVKLIVQDKPSPPRNLLPKDVTENSL
VLTWEAPEQLGGAEGVVEYVVEFREASTRSTKSVGTTPDMAMPVTKGLTVGKSYIFSVAC
KTEVGQSDFVETQPILMKLSYDVPSAPTNVRASVSPTRAEPEVQSVHLSWDSPPVADSAP
AESRPSHYLVEMRVAGGRTWQPVAKSQTITNPELTFLAKEESMSPEKLYEFRVAAVNKAG
TSEPSSPSNQIELGVALEFERPLEDLVIVEVKPTPYRLDCELSRNPRTAVSWTKDKKPFT
IPPNETRVRFVNEGTLQGIVFERITDADVGEYAIQVEHLSGQAKVEIKAPPAVLFSEDFQ
DRIILKAGSSKILEVPFVSTPKPQVDWTWASSSNPTQEQRPRFKPDIVAGLTTLPLSRVR
REDSGAYKVTIKNELGQISQVTHVTVIDKPSAPRKPRVTENNGETVVFEWNPPEDLGGCD
SPLEYVVSVRDASKRGTQATIVATVTDLKHTIEGLQVGKDYVFSVLARNEVGDSQAAETQ
PVTAKFAFDVPEAPGKPTVTVKETGKIALHWTAPSSDGGSPIVAYEIESLPTRIPVPGQR
RTSSVGVKPKFSTVTRGIQFAPDAQPEAEIEGLSPDMQYEFRVRAVNKAGPGSFSQPSDS
CVPLVKGPRVPNKPGTPSAEALSDSSVKVSWIPVTETEDFGPADAYQVELDEDGEGDWKV
VGTTTTPDACEFVAHKLDNSKRYLFRVRGVNKEGVGEPSKPSNQIYLKKDAPLAITKELE
SVLADSLPEVVSFECGISKAAQKVQWFHNGKRLDAAQIRKYRITDDVLSQRLEILKVTPE
DIGEYSIKVDKLESKATFALELAPRLCLPENFEDTIVLNQGASRTVEIPFMAAPKVDQID
WYWNGNPILPDGNKRAVPRNDMLGKAAIVFTKVERTDAGMYEAVIRNKFGEAKALLTLKV
LSGPGPVRALEANVESATELVLLWKPPAEGDDGGSPVTSYRVEQRLVAPAPGATARSYAR
EWSLVTTVDASSKIPEDDMFVCRLDKLIPETTYSFGVSAVNAIDTGVRTETLEGIFMKCP
HDKPESPTDIRAKPLDMHTVQLEYTLPKTSDAAPITEILLEYRPKGQSRWVSHEKLNGLL
NLWFSLTVPVANTATISKLEPGTEYEFRVSCSNVAGAGQPSRVVKAQTMEAPKPPGPPKL
FEVLPAALDQLIVKWKAPEEDGGAPVTAYEIEITDATGLELWNPVHTHPVSRTDSEPFEA
TIGKLDDTKTYKVRVVATNSIGRGEPSIPSKSVAPGEEVGIVRPLTDIYYDQIPGTGVSA
DLECELTHPNCRVQWLRGGRPIQLGRKYDFTPEGCVYRLSIRDITVDDFDVYQLTYKKLK
TEASVGAKIPPALREDVEMSSMRQVPVGSNFVLEVPFKAYPKPTVRWLAQGVTVTDSTKR
YRVDTVAGLTSLSIQRVQRDDEGELCVLIENEHGKLTWKCNLAVLDKPGPVERLTADVAA
SNTEILVSWKPPRGDGSSPLLRYELEFRNPKRRVWQLVKTGPQDDDDVLCIPPDTLEFAL
PSSDKETANSLASGTEYLFRVVAVNAVGKSEPVETRTPIKAPYRPKPPKLKYDVLLETSR
LNAGQKHFIPVTVEGTPVPKVTWLFTPDEKAAQPSEVLPQEVQADVGTAEKDKPNKVSLN
IKKATRKVQGVYTIVATNSGGEARAQFQVSVSDVPSAPLNLTAACSSKTSVRLTWSPPAD
TGGQKLTNYVVEQAETQNAYASPSDVALWQPVSSSLPVTEVTDSENVCTYEVSRLTTGKR
MFFRVAAQNKLGVGAFASIPEPIQVVSPHNLPGPPRNLRAVADKDGQVLLEWSTPQSDGG
SKIINYVVEKSTAASGAPWAEVPLPDSAETERVLKHLKEGECFLRVSAVNEAGRGSASNI
AEVTVKKVAAEPSAPGQPTVEVVSDGCVQLRWALPLDEGQGGPIKGYEIQVCEVGSTKWR
PLTDKLCPFNEIRLDGLGTDKDLMFRVVAVNQAGRSAPSESSRPIRLEIDVKFIRHLEPI
TITELPADAVFECELSRPGMNLIWSKDGRDLSLSTRCVYDVTGVGDKAFCVHRLTLVKLG
PSEQGHYAARLPTGVKSEADLVIECPPRIMYDASKDIELIAGKSSVIEVPYSGAPVPDVN
WSFNSGPLPVGPVKESPMASVDTVYGLTCLRLRQVNREASGSYKLVVSNELGKATLELKV
SVLDRPGPVRRLRCAVDDTQPSAAIVAWEEPKDAGGSPITGYIVEKREANKRSWTSLGPA
EPGLNRVATGLTPNTAYFFRVMAQNASGCSEPTETETPLVIPSKTKPPSAPGSPEVNDVG
TNSCRVSWQPPSSDGGARLAFYHLEKRANQKGNWVRATDGKLSIPESQVAAPYSINVMGL
VPDNVYEFRVAAENADSLVSDFSTPSHRISTQAPFSLPGKPSRPELKNVTEKSATLNWKA
PYDDGGDTIKRYIVQYKILSSAHWETVGEEPVDVEFTIRHLQPDQEYEFRVAAVNAAGQG
PWSDSSEPCVPAKVVESAKPNLVTPLANANVQVGESVELECEFKLGEPKGEVTWFKDGKP
IRSQVKYSTSPAWERRASLKVSRAKLEDAGVFTCRATNTVGTAETSCRLTVCQKPTLTLE
LDKGSSSQVTSAPGKNEVLAGRVGGRLVVKATCEAVPECEPMTWFIKGNRVESELTPDLR
SRVTINQPASTTSRTASTPTVQEAYLTISDLQLQDSGDIGVGPYDDRLRVRNCVPQMVYS
FRVSAQNDIGTSDATEIESPHHMKPLTDVPSPPTNVAVDRTSARDATVRWNAPLETGGDV
LQGYLVEIRESPDPSSAPASQWTHVSLVRSGTTYRANDLHPNMVVQFRVKARNAVGFSEP
SEPSDWVPPVAKEPDESERAGRRREPTDREKHLDKGRPDEQRDILAEMAALREAAKPKRD
VTGKLFLYAPVLKLLTGDEYRLRPANNLRVGAHVTYSTRATVSLLTGSGQPLTGSVLGRC
RVEQFGDDFYINLRNVDVSDAGNYMIRAENSAGASSAVIRLFVSTEPLPPTGPLSVKVVE
PVKGHTQGATVELSWNPSPLRPGESTEYAEPVLGYVVERRDGQRRTHFGCPIRLEGAKTL
STRVTDLKPGIEYVFRVSSHNAVGPSEPLLSEPIVLKTPFGVPDAPVGPLNCSDITDSSL
TLKWQPPLEDGGLPLKRYQLEIKDVGHPAGWVPLTSVPENVLSYVVSGLQPGFAYRFRVR
AVNDEGPGEWLETEKSIPFCRPTTNPSEPVAPLRLLPDGDNAVRLSWRPPLDDGGAPIKD
YIVEVCLDQSSDHWKPVGTTDGLSKRVDGLLPDGVYSFRVSARNEAEKVSIPLYSEIYKP
ASPVAPPGAPVGPLVARSIGIGQIQLDWKSPQVGGPHGYGVPEEYLIERYDSKRARWAYV
ARQPVSDGTSIVVTGLQSGGEYRFRVRAENRAGAGPALEMEKPVIATSPFSPPGAPVGPI
NISEVQKGPSKSDGSVRLSWRPPADTGGLPVQRYVTQMRYANTPGWHRIGRRQASLDEAQ
QLDDELAVPTTTLATSLMQGQRYVFRVAAVNAAGTGPFLESDVFEMPEDESCRPKADWVR
VVGKSADSVTVEWLVPHDCRHDHGPHRAHHLAIDNFRVFVRPATPAGAPEAPWKRVADLD
HYMNRLVVGDLRQDRSYYFGVAAVNQAGQGDIVSTKEPVSPEVITTVPSQPVGPLRAHDI
TDVGCTLTWSSPVSDGGSPLLGYRIYKREMYRRSWQEIGRLTETPGLPTAKQLSFAVQYL
MQATSYEFRVVAENKNGLSEPLDTHVNIHPAKATDVPGPPRGPLRVRELPEETGTLELSW
APPTESGGLPILGYQLEVREGRSFNWKPCPSDSQLVAVGPEHKHQPSHIVSGIQPNREYF
FRVSAVNKEGMGHPLVAEDSYVKRLNLAPPKRVLGRRLPQSEDEARTVKSILQVEWELPR
PLTHEPQPIGFQIERLDNDARSANWEIVDFLPISDASQTSFVHQSVAPRGTGSYKFRVST
VYPEGTSQPVMTGVILASAPTSSRPASAASREVLPSVPSVRLLEDTGLGYELEWVPPKGP
GADAIRGYSIEDWDSRRQKWQPVIDIPKSGPLKVSVAAPTALEPDHRMRIISRGDVGRSV
PTEFSLQPLVDETLRRPSTPTSAMEWKTLPSTTGYPLTTPHAPKSTAVLPMMDESDLELA
LITGVDTGTSEVEDFIRTRRQMAQDMARRDLASSMGRRSAMSQRSFDQELLWRPESTIDR
IPSRVSTRTPTYGIRVQGQLIAEELTPNSVRLSWSDDAFRPYEARKPDSYGIEKWDTRQG
KWITVGQARPRATEYIVKGLIPDDEGWWFRVVPLDHEGKSCGIPLQMESPLHPRPRHVTI
PSSVWGVELSPIYAPIEWEQGTMEVAWMKPSNDGGSNLLGYRLIVYDADAQEDREIIVPP
NQTNVRITSLNAMHVHRITITAFNRIGDSLPVTSTVPPRPGTQGMPPTPPPPAEFRADLF
GEPYSDQSVXSTVPPRTGTPGMPPTPPTPAEFRADLFGEPYSDQSVCQLSWRPPSRMTAP
IDFYLIEKWDSQSKQWIPFKKVPEGTYSIEIPYLLDDVEYGFRIRSQNISGFSQPVAIQS
RIRPGLAKEQGPHRMPLPPAKPSGPLEMIPTLVQDDTATRLQTAIDAAYRTIELRWQPTS
IREDSEDRAGPTRAYVIEARRREQRTWALLSRVPVTHGQRVRIIFGLEPDLWDRRVSASL
GRPSSALAQLPESASVDTLALGLLGTPYTSVLSGEPKDYEFRVLAENEFGRSEPLYATSW
SPGTEIPSRLSETSFRQALTDLDYPLPRPRGPIYLTPRVLVSRPSSRLESRAPDREEFEI
SWQPPYDTTGVSGYEVLYRSPYANRWYPIGKTGVTETSLMLPASLLEEFPTSIHVGIRTV
GDQLRGSSRRPTSDRLEEVLTIPTVSKHGVSTHHPPTVAVPVADELSILKPTEVRASLFQ
PTPSIRGSDEIIVDWSPSSLRPLSEHERVRETRRPEKYVIFARELGKSEWKEITQVPGLT
TTTQLQRSALPTARDIFLGVAPTVGSRIGPIVSTLDALRLPKDVGATSLPFREMPATILP
TEQFIVTPEGPDEAKIQWIPSADLLAKLDTYPMVDYQLQVRRPGDLTWRPITAERTGISS
RLIETPSQPSLMNFKVDHLKPGERFEIRIAARPSPMETLMPITEVTTSRLIPPYDIPSRP
RGPLVADFIRTKAPAHIRPSSTLDSFEIDKSVSSLLGRTTSKLPEDTAVQLSWHAPVDTG
GLPVTEYVIERRGGPVSALARDWVQVLTVPGTQTRALVPSPWVTYQTSTPYSYRVRAVNR
MGASSPLETARPLQIEDMSPSAPSSRPSSRVTYHLQPPLAPRGPLRSELLPYGSGVQLEW
LPPLLDGFGVGETYSHPATYVIEAAEADKPDAQWVELGRVPGTLSSAVVPLLPPSRFRTE
SGDRFTAIEDEWATYKPAPVLYRVRAENEFGLSAPLVTRIEPVLDRDLRTRLPRFQPGQF
IARVISETSVEQPPQIELRWPQLARSAPALATRIGRPAFEPAVTSDLGYLLEARRVGEFG
WHPIGTLPIGQESFVYRPTTYDYHVPRSRSALDAGHYRVEPTPTVPPSSVEAYQFRVAPI
TSRETGDFLESDIVSWTAPLRSATKPADYRRVHTPLPVAMHITPPSFSGPVLPSPERFQL
VDISVEKPVDGVPEDANFGSVVLRWRPPIGMPSTMRSAADFVVESWRPDRQQWWPVARCP
AAITAETVPGRYDIRIAGLPVNQLYHFRVLTQTTDSQSEPALLPQPVWIPRVDAEKRAIP
EPPKRLRVAPLIGDSPGVLLTWLPPTTFSMEDFIPSTLRRSTVGYSAPPAGYLIEYQTVS
DRTGELSTWKHLAELESWQTRFEARDLEPGKQYIFRVTSIGHGPDRLKTSILSRRSSRAA
PLLSEPVQTEPYKVPSTKLSTIRLTGELLVEPVTRYTKTPSVSLTWVPSKEPLSGYVVDL
YDLDLPTGWQTVARIPATDLQAPFSGVTVGDLIPGHSYRFRVLPYRDDIYGKPIQTMRLY
TVPESRHEAQEDLTFDRIQLPAPQGPLRVDRLSSDICRLSWRAPRLPLSIEPTRRERLES
QFEYVIEQRLPHRRMWYEVGRTRELHYLTPLDTTSQFRIRTIFSEVSEHEAKHTFALSYD
SLKSDWVTVREGVEDVYYRTAKRRRSADTEFDLGNFVPDRLIAKHIGRTSVLLEWTANEL
KVPTYGYMLLEKRLIDQHRLGIWEPVARIPWTPGTTSYEVLGLRSGSSYEFRLLGVDEQT
GARSTKVAYLPSAITTGGFAETSEAALVTWLTAPRRLRAHVRSDNAEEGIQLTWLPPELS
DQALTRVRYKLEAREVDSSGSLITDWLVVSKDIARTEYYVSRAKVDEMSSKAVALESRDL
LPGKKRRPVSSMDLERRQWQFRVTASCDKAESVPAVIQEPIAIVPPKRRVPIRFLNLKED
RIIYSVLGQRLVITVEVEGEPTPSVAWYLNHIRLDDRISSDYRVGRVGAGVFELTIDRVQ
RNHAGLLECRAWNAYEMVSNKWEIVVAAVPRFSRFDWSLDVREFEVKHGDSWELRIPLED
WDCTQGHEWITKVWLERLTRIPALADTGKFPESLESRVRLRIIEGLRWVELLVDSISLTD
AGVYRLWIQNQAGRDYLDFRLRVADKPHVRPNKPRVLPHGPGTLVIYWDIPLPTSRLEAE
IKYTGYRVEYRREQPGASWNFLGSTPAEQTQILVRSPLEPEVTYRFRVCLENWHGYGPAS
EPSDPVQLPTHSITDVYDVMDEVLPYADGSFESRYTIMEELARTKHAGLYRLVEKSTGRS
YLAKIVDTSRGSTERLHTSALGYRSEQARRDSLPPRPVSAMDTGRLMDRRVTSQLSLSRT
SLTDSDEWRRQRTEQELKLLTKIQHGALAKFHEAYQDARRTVAIMEDVTAGGTLWHQLSH
RITMTETKAAEILRQLLDLTNQLHRSGFVHLGLQIYYIAFDLNRTTGDTEGPPELTRMER
LQLSPKMVKFTKRLLHPDPSKRPTAAEALRDPWLTSITTQAEPRPSVTSLTGRQRLSGES
LIDEDLLTHNVAESISKQAYTRLLRWIDASHAAEQDEREVEELISVRRRRHSQQYLREME
TEVFESRKDIVVHAHVTARGQAPEILTPMGSVSVEEGGPAVLKCAVHLPRPRKSTTPLDR
MSNLKIYWYLNGRELKLSEPTVKLTQPQRQHYMCTFDPDTGDVRLHIDEVTTYDAGTYEV
RVVGQYGEVSDSANLRVYAAPHRPSSRIELQASEELGARILLPLVDVSAASGNRIQLKAK
VAGIPLPRCTWLHNGVPLVASTRRRFYQEETGGLHSSELQLTLELVSLNTADSGLYTLVA
TNKHGSQSCSAVVDVLGTLNEDYEAPHFLVELTSTTVVEGSAARFEACVRGQPAPTVRWL
KDGKPLLTDGIRLTVSQSSTERSTTNTTSHTLLVRDALLRDSGTYTCIATSAAGTAITEA
ALHVRGLFNRGMPGGSESLGIRHRLPEFTRRLRNQQIVLGGNIRLAASVLAQPSATVIWQ
RDGVEINTNLEPRITAKNQSGHLELVIENVTREDLGQYTVIAYNAAGEARCSCVLSVLEE
HQFRLPQFTRELRDHTVLEGNNIFLEAIATGEPPPDFKWEKDGFEILPDGIDAQRIVPSV
NGLGHACLTITKARLSDAGLYRCIAHNRYGRERCTAFVYVEAIGRRGSTDRHALGTGLPL
GRGRSLPPVGSGRYAPGTDRPPSLPRLTEDEISTRRQGSSISPKPDGYLSVIRPLPSHIQ
VEEGDTLNLTCLVSSNIHYIRAKSASSGHPVITLPYPEHICCDLPNLPDALGIRRPSTDL
SYISSPTLNNTTVLLHSKCLI
NT seq 32826 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgacggatgcaacacgatggcaagatgtgtccgctgatttcaccatcaccgag
acgcattgtacgttaccgtcaaagggtctgaaagaattcacgagctatgagtttcgcgtg
acagctgagaataaggctggcaagagcaaaccatcgggaccgtctaatccagtggaattg
ggtatcccgctagagttcattcgcccactaactgatgtcgctctgactgaagcaacagaa
caaccagttgtagttgaatgcgagctgtcacgtactccacaagggaaagttcaatggctg
aaggacggaaagccactgagccgtcttccagaccgcgtccgaattgaggaagactcaaat
ggtactgtgcaccgactagtattccacccattaaccgaagaagatttgggtgtctacaca
ataaaagcggacaaaataagtagtgaggcacgagtggatatgaaaattgcaccagttctc
aaactttccgagaagttcaccgataaaatcatcctcaaagctggagcatccaccgtcatc
gaggtaccgttcgccgccagtccaaaaccaacagtccaatggacatggaagccgagactg
cgtcctgatgccgaaccaggtgcaccacaagctcctcgattcaaaccagatgtggtctcc
ggaatgacgtcgctaccactgggcaaggtgaaacgggaagacgctggtgactatgaggtg
gtgataaagaacgagttgggcgaggtgtcggtgacggtgcagttgatagtgttggataag
ccatctgcaccacgacaaccggacgtgagtgagaacacgggagaacgtggagtgttccat
tggattgacccggaattcctcggtatcagtccggatgtcgctccaactgaaggtataacc
tacattgtggagatgcgtgaagccaatcaaagggcaggtaaaccggtaacgacgacgaag
gaactgagtacgcctattgatgggttgcagttgaacaaatcgtacattttcagtgtggcc
gcgaagaacgaagttggtcaatcagactttgtggatagcaagccagtgtcaaccaagctc
gaatatggaccacccccaagtcccgttaacttgaaggctacagtcaacccagaaaaagct
cccgccgatcagcaaactattgagctcacgtgggaacagccgactgaccaagcgaccagt
gccggacctgtgaccaactactacctcgaaatgaagccgacggatgcaacacgatggcaa
gatgtgtccgctgatttcaccatcaccgagacgcattgtacgttaccgtcaaagggtctg
aaagaattcacgagctatgagtttcgcgtgacggctgagaataaggctggcaagagcaaa
ccatcggaaccttctaatccagtggaattgggcattccactggagtttgttcgtccacta
aatgacgttaccgttactgaagtgacagagaagccggtcgtaatagaatgtgagttttcg
cgagccccgcgagaaaaagttctgtggctgaaagatgggaaaccccttggtcgcgcccct
gagcgcgtccgtgttgaggaggatgcagacagcacagtgcatcggctggtctttcaacct
ttgcaggatgaggatttgggaacctacgcaattaaagtggagaagctcgtcagtgaggca
aacgttggtatgagagtggcaccaacactgaaactttccgagaagttcaccgataaaatc
gtcctcaaagctggagcatccaccgtcatcgaggtaccgttcgccgccagtccaaaacca
acagtccaatggacatggaagccgagagtgcgtcctgatgccgaaccaggtgcaccacaa
gctcctcgattcaaaccagatgtggtctccggaatgacgtcgctaccactgggcaaggtg
aaacgggaagacgctggtgactatgaggtggtgataaagaacgagttgggcgaggtgtcg
gtgacggtgcagttgatagtgttggataagccatctgcaccacgacaaccggacgtgagt
gagaacacgggagaacgtgtggtgttccattggattgaaccggaattcctcggtatcagt
ccggatgtcgctccaactgaaggtataacgtacgtcgtggagatgcgcgaggcaactcaa
cgtgtgggcaagccggtaacgacgacgaaggaactgagtacacctattgatgggttgcag
ttgaacaaatcctacatcttcagtgtggccgcgaagaacgaagttggtcaatcagaattt
gtggatagcaaaccggtgtcaacaaaactggattacggaccaccacccagcccgatcaac
gtcagggctgtagctagcccagagaaagcgcctatcgatcaacaaagtgtcgatgtgacg
tgggaacagccgactgaccaagcgaccagtgccggacctgtgaccaactactacctcgaa
atgaagccgacggatgcaacacgatggcaagatgtgtccgctgatttcaccatcaccgag
acgcattgtacgttaccgtcaaagggtctgaaagaattcacgagctatgagtttcgcgtg
acggctgagaataaggctggcaagagcaaaccatcggaaccgtctaatccagtggaattg
gatttgcctccgttgtttggtaaagctgcttcgtttgttccttcaggtgttccgctggaa
ttcgtccgtccactatcagatgtgcttttgacaaaggtgtctgatggacctgtgatattg
gaatgtgagctatcccgcgctccaagagataaggttcattggctgaaggagggaaaacct
cttggtcgcctacctgatcgcatccgcgttgaggatgacgccaatggtactatacaacgt
ttggcttttcaatcactgcaagatgacgacctgggcgtatatacaatcaaagtggagaag
ctaagcagcgaggcacgtttggatatgaaagcgaccagtgccggacctgtgaccaactac
tacctcgaaatgaagccgacggatgcaacacgatggcaagatgtgtccgctgatttcacc
atcaccgagacgcattgtacgttaccgtcaaagggtctgaaagaattcacgagctatgag
tttcgcgtgacggctgagaataaggctggcaagagcaaaccatcggaaccgtctaatcca
gtggaattggatttgcctccgttgtttggtaaagctgcttcgtttgttccttcaggtgtt
ccgctggaattcgtccgtccactatcagatgtgcttttgacaaaggtgtctgatggacct
gtgatattggaatgtgagctatcccgcgctccaagagataaggttcattggctgaaggag
ggaaaacctcttggtcgcctacctgatcgcatccgcgttgaggatgacgccaatggtact
atacaacgtttggcttttcaatcactgcaagatgacgacctgggcgtatatacaatcaaa
gtggagaagctaagcagcgaggcacgtttggatatgaaagtggcaccaacactgaaactt
tccgagaagttcaccgataaaatcatcctcaaagctggagcatccaccgtcatcgaggta
ccgttcgccgccagtccaaaaccaacagtccaatggacatggaagccgagagtgcgtcct
gatgccgaaccaggtgcaccacaagctcctcgattcaaaccagatgtggtctccggaatg
acgtcgctaccactgggcaaggtgaaacgggaagacgctggtgactatgaggtggtgata
aagaacgagttgggcgaggtgtcggtgacggtgcagttgatagtgttggataagccatct
gcaccacgacaaccggacgtgagtgagaacacgggagaacgtgtggtgttccattggatt
gaaccggaattcctcggtatcagtccggatgtcgctccaactgaaggtataacgtacgtc
gtggagatgcgcgaggcaactcaacgtgtgggcaagccggtaacgacgacgaaggaactg
agtacacctattgatgggttgcagttgaacaaatcgtacatcttcagtgtggccgcgaag
aacgaagttggtcaatcagaatttgtggatagcaaaccggtgtcaacaaaactggattac
ggaccaccacccagcccgatcaacgtcagggctgtagctagcccagagaaagcgcctatc
gatcaacaaagtgtcgatgtgacgtgggaacagccgactgaccaagcgaccagtgccgga
cctgtgaccaactactacctcgaaatgaagccgacggatgcaacacgatggcaagatgtg
tccgctgatttcaccatcaccgagacgcattgtacgttaccgtcaaagggtctgaaagaa
ttcacgagctatgagtttcgcgtgacggctgagaataaggctggcaagagcaaaccatcg
gaaccgtctaatccagtggaattgggtgagttgtgttttcagttcactatgtccaaatgg
actgtacgtccggtttatttattctcctcttctaggtcgcatttgggaatgtcctattat
accaatttccttgctcatctaggcattccgctggaattcattcgtccactcaacgacttt
gttctcactgagccgacgggtgaaccaatcgtgttagaatgcgagttatcacgtgctccc
aaagagaaagttcaatggttgaaggacggaaaaccattgcttcgtcttcctccccatgtt
cgtgtggaacaagataagaaaggagcggtccatcgattggtgttccaactgttgcaggat
gaggatttgggcatgtattcaatcaaagctgatcacttgaccagtgaagcacgagtagac
atgaaggcacagatcttcagcgactctcaactttacttgatcgatttgcataactatacc
cctgaacctctaccatacacagttgcaccagttctgaaactgtccgagaagttcaccgat
aaaatcatcctcaaagctggagcatccaccgtcatcgaggtaccgttcgccgccagtcca
aaaccaacagtccaatggacatggaagccgagactgcgtcctgatgccgaaccaggtgca
ccacaagctcctcgattcaaaccagatgtggtctccggaatgacgtcgctaccactgggc
aaggtgaaacgggaagacgtggcaccaacactgaaactttccgagaagttcaccgataaa
atcatcctcaaagctggagcatccaccgtcatcgaggtaccgttcgccgccagtccaaaa
ccaacagtccaatggacatggaagccgagactgcgtcctgatgccgaaccaggtgcacca
caagcttctcgattcaaaccagatgtggtctccggaatgacgtcgctaccactgggcaag
gtgaaacgggaagacgctggtgactatgaggtggtgataaagaacgagttgggcgaggtg
tcggtgacggtgcagttgatagtgttggataagccatctgcaccacgacaaccggacgtg
agtgagaacacgggagaacgtgtggtgttccattggattgaaccggaattcctcggtatc
agtccggatgtcgctccaactgaaggtataacgtacgtcgtggagatgcgcgaggcaact
caacgtgtgggcaagccggtaacgacgacgaaggaactgagtacgcctattgatgggttg
cagttgaacaaatcctacgtcttcagtgtggccgcgaagaacgaagttggtcaatcagac
tttgtggatagcaagccagtgtcaaccaagctcgaatatggaccgccagcaactccgatc
aaagtgagagctactgtcaacccagaaaaggcgccaataactgaacaaagcattgacctc
acatgggatgaacccaccgatcaaccgagtggtgcggggcctgtaacgaactactacatc
gagatgaaaccgaccgattcaaatcgatggctagatgtgaccgctgatttcaccatcacc
gagccgcactgcaccttaccatcaaagggtatgaaagaattcgcgagctatgaattccgt
gtgacagctgagaacaaggcgggtaaaagcaagccgtcagaaccatcgaatgcagtagaa
ctaggtattccattggaattcgttcgtccactgaatgagatcgccctcaccgagctcact
aatgaaccagtcgtcttggaatgccagttatcacgtgctccgaaagagaaagttcaatgg
ttgaaggacggaaagccattaagccgtcttcctgctcgcgttcgtgttgaagaagatgag
aagggaaccgtgcatcgattggtcttccagccactggaggatgaagatcttggcacgtac
acaatcaaggcagagaaactgagcagcgagggaagggtagacatgaaactcgccccaact
ctgaagctttccgagaaattcaccgataaactcatactcaaagctggagcatccgccgtc
cttgagataccgttcgccgccagtcctaaaccaacagtccagtggtcatggaaaccaaga
ctgcgccccgatgccgaacccggtgcaacacagacaccgcgatttacgccagacatcgtc
tccggtatgacatctttaccgctggggaaggtgaaacgcgaagatgctggtgactacgtg
gtagtgattaagaacgagttgggcgaagtttctgtgacagtgcagttaatcgtgctagac
aagccatcaccacctcggcagcctgaagtgaccgagaacactggtgagcgtgttgtattt
cagtggcttgaaccggaattcctcggcctcagtccagatgtgtcacccacggacgcagta
acttacgtagtcgaaatgcgcgagtcaacacagcgtgtgggtaagccagtgaccacgacg
aagaaattacaaacgtcaattgaaggattgcagctgaataaatcgtacattttcagcgtg
gccgcgaagaacgaagttggtcagtccgactttgcggatagcaaaccagtttcaactacc
ttagactatggaccaccttcgagtcccaaaaacgtgaaagctgttgttaacccggccaaa
gctccggtgtccgatcagacgattgatctcacctgggacgaaccgagtgacaaagcggtt
gggcccgtgaccaactacaccctcgaactgaaaccgaccgactctactcggtggcaagac
gtgtccggcgaattcacgataaccgagccacattgcacactgccatccaaaggcatgaag
gagttcatcagctatgaatttcgtgtgacagctgagaacaaggccggaaagagtaagccg
tcggaaccgtccaacccagtagagttaggacatgtaattccgcgaatgttcagttgttat
ccgtcccttttcatacatcgtttttctagctatgaatttcgtgtgacagctgagaacaag
gccggaaagagtaagccgtcggaaccgtccaacccagtagagttaggaatcccgctggaa
ttcatccgtccacttactgacgtgtctgtgacagaactgaccggggaaccgattatattg
gaatgtgaattgtcacgcgctcctcgggaaaaagtccagtggctgaaggatggtaaacca
ctaggtcgtcttccagaccgtgtcagtcttgaagaaggttcgaaaggtaccgtacatcgt
ttggtgttccagcagttgcacgatgaagacctcggggtctatacaatccaggctgagaag
ctgagtagtgagggtcggatagatatgaagttggcaccaactttgaaactttccgagaag
ttcaccgataaaatcatcctcaaagctggagcatccaccgtcatcgaggtaccgttcgcc
gccagtccaaaaccaacagtccaatggacatggaagccgagagtgcgtcctgatgccgaa
ccaggtgcaccacaagctcctcgattcaaaccagatgtggtctccggaatgacgtcgcta
ccactgggcaaggtgaaacgggaagacgctggtgactatgaggtggtgataaagaacgag
ttgggcgaggtgtcggtgacggtgcagttgatagtgttggataagccatctgcaccacga
caaccggacgtgagtgagaacacgggagaacgtgtggtgttccattggattgaaccggaa
ttcctcggtatcagtccggatgtcgctccaactgaaggtataacgtacgtcgtggagatg
cgcgaggcaactcaacgtgtgggcaagccggtaacgacgacgaaggaattgagtacgcct
attgatgggttgcagttgaacaaatcctacatcttcagtgtggccgcaaagaatgaggtt
ggcaagtcggactttgtcgacacgaaacctatttcgacaaaacttgattatggcccccca
agcccacctacgaatgtgtgcgcagctgtgtcccctgaaaacatctccatcaagcaacaa
caaatcaatgtgtcctggactcctgatgaaactcagccgtctgccacaccagtactctac
tacatcgtggagatgagggctgtaggtgaccggtcgtggagttcacctggcctcaactct
gacaaagtcgagggactcaattttgttgttgactgtagccgtctaaaggaggagcaacct
tacgaattccaggtcacgggggtgaataaagctggcaaaagtcaaccttcgaacccttca
aatcctgttgtattgggttgtccactcaagttcattcgtccacttcaagacgttatcatt
caagagtacacgggtcagcctgttgtgttagagtgtgaggtgtcacgtgagccaagagaa
ccagtgacctggtcgagagatcgtaaaccacttttggtgcgcgcaaaagctgatgactat
cgtatcgaatcagacaagcaggacacagtgcaccgcattgttctacccttcctaactgaa
gaattcatgggaacgtacaaaattgatgtggaaaaactcagttcggaagccaacgttgaa
ttcaaaatatcgccgacgctacgcctgtcagagacgttcagtgataaactaatactgaag
gtcggtgcttcatccacaatagagatcccattcgtagcagtcccaaaaccgacagtcgaa
tggacatgcacactgatatcggccaaacgaggcgaccagaaaccacggttcagagatgaa
accaacatgtctatgacgcggctgaacctgaataaagtacaaatggaagatgccggagac
tatcgcgtggtaattcggaacagactgggagaggtaactgccaaagtgaagttgattgtg
caggacaagccgtccccacctcgtaacttattgccaaaagatgtgacagagaattcgctt
gtactcacgtgggaggctccggaacagcttggcggagctgaaggtgtagtggaatacgtg
gttgaattccgtgaagcgtcgacacgttcaactaaatcagttggcactacaccggacatg
gcgatgccggttaccaaaggattgactgttggcaaatcgtacatattttctgtagcctgc
aagaccgaggtgggacagtcggactttgtggaaacccagccgattcttatgaaattaagc
tacgatgttccatcggcaccgaccaatgtccgtgcgtctgtcagtccaactcgtgctgaa
ccggaagtacaaagtgttcatctgagttgggacagtccaccagtcgcggattcggcaccg
gctgaatcacgtccatcgcattatctggttgagatgcgagttgctggtggacgaacatgg
cagccagtggccaaatcccagacaatcacaaatcccgaactgacgttcctggcaaaagag
gaatcaatgagtcctgagaaactttacgaattcagagtcgctgctgtgaacaaagctgga
accagtgaaccatccagcccatcaaatcagattgaacttggcgttgcgctggaattcgaa
agaccattagaggatcttgtgatcgttgaagtgaaaccaactccctatcggttggactgc
gagttgtcgcgcaatccaaggacagctgtatcatggactaaggacaagaagcccttcacc
attcctccaaatgagactagagtccgctttgtgaatgagggtacacttcaaggaattgtg
ttcgaacgtatcacggacgcagatgtgggtgaatatgccatccaggttgagcatctatcg
ggccaggccaaagtggaaatcaaagctcctccagcagtgctattttctgaagatttccaa
gatcggatcatactcaaggctggttcgtccaaaatactcgaagttccgtttgtctcgaca
ccgaaaccccaggtcgattggacgtgggcatcaagttcaaacccaacacaggaacaacgg
ccccgattcaagccagatatcgtagccggattgacgacgcttccacttagtcgtgttcgt
cgtgaggatagcggtgcatacaaggttactattaagaacgaattagggcagatctcacaa
gtgactcatgtcaccgttattgacaaaccgtcagcgcctagaaaaccccgagtcactgag
aacaatggagagactgtcgtctttgaatggaacccaccggaagaccttggtggatgtgat
agtcccttggagtatgttgtgagtgtacgtgatgcgagtaaacgaggaactcaagcaacg
atcgtggctacggtcactgaccttaagcacacaatcgaagggctacaagttggtaaagac
tatgtattttctgtcttggccaggaacgaagttggagattcacaagctgcagaaactcag
ccagttacagcgaaattcgccttcgatgtaccggaagctcccgggaaaccgactgtgaca
gtaaaagaaactgggaagattgctctgcactggacagctccttcatctgatggtggatcc
ccaattgttgcgtacgagattgaaagtttgccaacccgcatacctgtcccaggtcaacgc
cgcacttcatccgttggagtgaaaccaaagttttctacggtgacaagaggaatccagttc
gcgccagacgcgcaaccagaagcggaaatcgaaggtttatcccctgatatgcagtatgag
ttccgagttcgagctgtgaacaaggcgggtcctggaagtttcagccagcccagtgactct
tgtgtacctttagtcaaaggtcctcgcgtacctaacaaaccaggaacaccgtccgcagag
gctctaagtgattccagtgtcaaagtttcctggattcctgtgactgaaacagaagatttt
ggcccggctgacgcatatcaagtagaactggacgaggatggagaaggtgactggaaagtt
gttgggacaaccaccacaccagatgcgtgcgaatttgtggcgcataaactggataattcg
aagcgctacctgttccgagtacgaggtgtgaataaggaaggggttggagaaccgtccaag
ccttccaatcagatttacctgaagaaagacgcgccacttgcaattacaaaagagctcgaa
tcagtcctggctgattccctcccggaagtggtgtccttcgaatgtggtatctcaaaagca
gcccaaaaagtccaatggttccacaacggcaagcgtttggatgctgcccagatacgtaaa
tacaggattacagatgacgtcctatctcagcgacttgaaatcctcaaggtcacgccagag
gatattggtgaatactcaatcaaagtggacaaacttgaatcgaaggctacgtttgcctta
gaacttgctccacggctgtgcctcccggagaatttcgaagacactattgttctcaatcag
ggtgctagccgcaccgttgagattcccttcatggctgctcctaaggttgatcagattgac
tggtattggaacggaaatcctatacttccggatggaaacaaacgtgctgtgcctcgcaat
gatatgctgggtaaagcagcaatcgtgttcacaaaggtggaacgcacagatgctggaatg
tatgaggcggtaattaggaacaaatttggagaggccaaggcgttgctcacactgaaagta
ttatcaggccctggtcccgtgcgtgcacttgaggccaacgtggaatcagcgacagaacta
gtactgctctggaagccaccggcagagggtgacgatggtggaagtcctgtgacatcgtat
cgggttgaacagcggttggttgcacctgctcctggtgccactgcaaggagttatgcccgt
gagtggagtttagtcaccactgtggatgcgtcgtcaaagatccccgaggacgatatgttt
gtttgtcgtttggataaactgattcctgaaactacttactctttcggagtgagtgccgtg
aatgcgatcgatactggcgtacgaacagaaacgctcgaaggcattttcatgaaatgtcca
catgataagccagaaagtcccacggacattcgtgcaaaaccgttggatatgcacaccgtt
cagctagagtacactcttccaaagacctcggacgctgcgcccatcaccgaaatcttgctg
gaatatcgtcccaaggggcaatcgaggtgggtttctcatgaaaaacttaatggtttgctg
aatctgtggttttccctgactgttccggtcgccaacacagcaacaatttccaaactggag
cctgggaccgagtatgagtttcgtgtgtcgtgctcaaacgttgctggtgctggccaacct
tcaagggttgtgaaagcacagacaatggaagctccaaaaccacctgggccaccaaaacta
ttcgaagttttacctgctgctttggatcaattgattgtcaaatggaaggcccccgaagaa
gacggcggagctcccgtcacggcgtatgagatcgagatcaccgacgccacaggactagag
ctatggaatccggtccacacgcatcccgtaagccgaacagacagcgagcctttcgaagca
accattgggaaactggacgatacgaagacatataaggttcgcgtggttgcgacaaacagc
attggtcgaggtgaaccatcaattccttccaaatcggtcgccccaggtgaagaagttggg
atcgttcgtccattgaccgacatatattatgatcaaatccctggcactggagttagtgcg
gatctagaatgcgaactaacacacccgaattgccgcgttcagtggttacgcggaggaaga
ccaattcaattaggacgaaagtatgacttcactccagaaggatgtgtttaccgtttaagc
atccgagatatcacggtggacgatttcgacgtataccagttgacgtacaagaaactaaaa
acggaagcgtcggtcggggccaaaattcctccggccttaagggaagatgtggaaatgagt
agtatgcgtcaagttcctgttggttctaacttcgtacttgaagtccccttcaaagcctac
cccaagccaaccgtcagatggcttgcacaaggtgttaccgtaaccgactctaccaaacgc
tatcgtgttgacaccgtggccgggcttacctcattgtccatccaacgggtccaacgggat
gatgaaggcgaattatgcgttctgattgaaaacgaacatggtaaacttacgtggaaatgt
aacctggcggttctggacaagcccgggccagttgaacgactaacagctgatgtggccgcg
tcgaacactgagatacttgtcagctggaagccaccgcgaggcgatggaagcagtccactg
ttgaggtacgaattggagtttcgaaacccgaagcgacgtgtatggcagttggtgaaaacc
ggtccacaagacgatgacgatgtgctctgcattccaccagatacgctagagttcgcctta
ccttcgagtgacaaagagaccgcaaactcattagccagtgggacagagtatctgttccgc
gtggttgcggtgaatgctgtcggcaagagtgaacccgtcgaaacccgaacaccgatcaaa
gctccgtacagaccaaaaccgccaaagctgaaatatgacgtactgctggaaacatcacgt
cttaacgccggtcagaagcatttcatccccgtcactgtggaaggcacgccagtgcccaag
gtaacatggttgtttacaccggacgagaaggcagctcagccgagtgaagtattgcctcaa
gaagtccaagctgatgtcggtacggctgagaaggataaacccaacaaggtctcgctgaac
atcaaaaaagctactcgcaaggttcaaggagtgtacaccattgtggctacaaatagcgga
ggggaagcacgcgcacagttccaagtatcagtttctgatgttccttctgcaccacttaat
ttgaccgctgcgtgctcgagtaaaacctctgtgcgccttacttggtcgcccccggcggac
accggaggtcagaaactcaccaactacgtggtcgaacaggctgagacacaaaacgcttat
gcgagtccatctgatgtagcactttggcagcccgtcagcagtagcctacctgtcacagag
gtgaccgatagtgaaaatgtgtgcacttacgaggtctcccgattgactacaggaaagcgc
atgttcttccgcgtggcagcgcagaataaactcggagttggagctttcgccagcattcct
gagcctatccaagtggtctcaccacacaatctccctggacctcctcgaaaccttcgtgct
gtggcagacaaggacggacaggttttgcttgaatggagtacaccacagagtgatggcgga
tcaaagattatcaactacgtggtcgaaaagagcactgcagcaagtggtgctccgtgggct
gaggtacctttgccagactcggctgaaactgagcgtgttttgaaacatctcaaagagggc
gaatgtttccttcgtgtatcagccgtaaacgaggctggaagaggttctgcatcaaacatt
gcggaagtgacagtgaagaaggttgcagctgaacctagtgctccaggtcagcctaccgtg
gaggtggtatccgatgggtgtgttcaacttcggtgggctcttccgttggatgaaggtcag
ggtggtccgatcaagggttatgaaattcaggtgtgcgaagtggggtcgacaaagtggcga
ccgctaacggataaactctgtccctttaacgagatacgtcttgatggtcttggaacggac
aaagacctgatgttccgtgtggtggccgtcaatcaagctggaaggagtgctccgtcggaa
agcagtcgtccaatacgtttagaaatcgacgtcaagttcattcgacatcttgagccaatc
accattaccgagttacctgcggatgctgtgttcgagtgcgaactttcacgacctggtatg
aacctgatctggtccaaggatggtagagaccttagtctgtccacacggtgtgtttacgac
gttacgggagtcggagacaaggcgttctgtgttcatcgactaactctagtcaaactgggt
ccttctgagcaaggtcattacgcagcccgtctcccgactggcgtgaaatctgaagcggac
ttagtaattgaatgtcctccacgaatcatgtatgacgcatccaaagatattgaattaatt
gctggaaagagtagcgttattgaggttccttattctggtgcgccggtacccgacgtcaac
tggtcattcaactccgggccactgcctgtaggaccggttaaggaaagtcctatggcgagt
gtggacacagtctacgggctgacttgccttcgtctacgtcaagtgaaccgcgaggcatct
gggtcttacaaactcgtggtgagtaacgaactgggcaaagcaaccctggaactcaaagtt
tctgtgcttgaccgtcctggacctgttagacgtctccgttgcgccgtagatgacacacaa
cccagtgctgctattgtagcttgggaagaaccaaaagatgcaggtggttcacctattacc
ggatacattgtggagaagcgtgaggcaaacaagcgaagctggacctctcttgggccagct
gaacctggcttgaatcgtgtagcgaccggactaacgccaaacaccgcctactttttccgt
gtcatggcccagaatgcttctggttgttcagaaccgactgagactgagacccccctggtg
ataccgtccaaaacaaaaccaccgtctgccccagggagtcctgaagttaatgatgtcggc
accaactcgtgtcgagtgagctggcagcctcccagttcggatggaggagcgcgattggct
ttctaccacttggagaaacgggccaatcagaaaggcaactgggtccgtgcgacagatggc
aagctatccataccggagtctcaggttgcagctccgtatagcatcaacgtaatgggtcta
gtacctgacaatgtttatgaatttcgcgtggcagcggaaaacgctgacagtctggtcagc
gatttctccacaccgagtcaccgcatttccactcaagcaccgttctcgttacccgggaag
ccatctcgaccagagctgaaaaatgtgactgaaaagtcagctacgttgaactggaaagct
ccttacgacgacggtggtgataccatcaaacgctatatcgtgcaatacaagatcctctca
tctgcccactgggaaactgtgggtgaagaaccggttgacgtggagtttaccatcagacat
ctgcaacctgatcaagagtatgaatttcgagtggcagccgtgaacgctgctggacaaggt
ccttggtcagactcatcagaaccatgcgttcccgcgaaagttgttgaatcagcgaagcca
aacttggtcactccccttgcaaacgctaacgtacaagttggcgaatctgttgaactggag
tgtgaatttaagttgggtgagccaaagggtgaagtgacttggttcaaggacggtaaacca
attcgaagtcaagtcaagtattctactagcccggcctgggaacgtcgagcttccctcaaa
gtgagccgagcaaaactagaggacgcgggagtgttcacttgtcgcgcaacgaacactgtg
gggacagccgaaacatcgtgccgcctaactgtctgccagaaacctacactgactctagaa
ctggataagggatcatctagtcaagtcacatctgctccaggcaagaatgaagtgctcgct
ggacgtgtcggtggcagactggtagttaaagcaacttgcgaagcagtgcccgaatgtgag
ccaatgacttggtttatcaagggtaaccgcgtcgagtctgaattaactcctgacttgcgt
tctcgagtaacaatcaatcaaccggcatcaaccacgagtcgaacagcctcgacacccaca
gtacaagaagcgtaccttacaatcagcgatctacagttacaggacagtggcgatatcgga
gttggaccttatgacgaccggctaagggtgcgcaactgtgtgcctcaaatggtgtattcc
ttccgtgtctcagcacagaacgatattggaacgagtgatgcaacagaaatagaatcgcct
caccatatgaagccactgacagatgtaccctcaccacccacgaatgtggctgtcgatcgc
acatcggcgcgtgacgcaacagttcgctggaatgctccgcttgaaacgggcggggatgta
cttcagggttatttggtagaaatacgtgaatcgccagatccgagttcagcaccagcctct
caatggactcacgtatccctcgttcgatctggaactacttatcgtgcaaacgatctgcat
ccaaatatggttgtgcaattccgcgtgaaggcacgcaatgcagttgggttcagcgaacca
tccgaaccatccgattgggtgccacctgttgccaaagaacctgatgaatcagaacgagct
ggacggcgtcgcgaacccactgatcgcgagaaacatctggacaaaggtcgaccggatgaa
caaagagatatcttagcagaaatggctgcgttacgagaggctgccaagccgaagagggat
gttacgggcaagttatttctgtatgctcctgttctgaagctgttaacgggagacgaatat
cgtctccgacccgccaacaatctgcgtgtcggagctcacgtgacctactccacacgtgcc
accgtgagtcttctgactggtagcggccaacctctaactggatctgtgcttggtcggtgc
cgtgtagaacaattcggtgatgatttctatatcaatcttcgtaatgtggatgtcagtgat
gccggaaactatatgatacgcgctgagaactcggccggggcaagcagtgcggtgattcgc
ctgtttgtgagtaccgaaccacttccacctactgggccactttctgtcaaagtggtcgaa
cctgtgaagggccacacacaaggtgcaactgttgaactctcatggaatccgtcccctcta
cgtcctggcgaaagcacagaatatgcggaacccgtactgggttatgtagttgaaagacgt
gatggacaaagacgcactcattttggctgtcctatacgtctggagggagcgaaaactttg
tcaactcgagtcactgaccttaaaccgggtattgagtatgtgttccgtgtctcttcgcac
aacgctgttggtcccagtgaaccgctcttgtccgaaccaatagtgttgaaaacaccattc
ggcgtacctgatgctccagttggtccactgaattgctccgacatcacagattcctcgctc
actttgaagtggcaacctcctcttgaggatggcggtcttccactcaaacgttatcagctg
gaaataaaagatgttggccatccggctggttgggttcctttgacatccgtgcctgagaac
gtgctaagctacgtagtcagtggtttgcaaccgggtttcgcctatcggttccgcgttcgg
gcagttaatgatgaaggtcctggtgaatggttggaaacggagaagtccatcccgttttgt
cgaccaacgaccaatccttctgagccggtagcacctctccgactgcttcctgacggtgac
aatgcggtgcggctgagttggcgtcctccgttggacgatggtggtgcgcccattaaggac
tatatcgttgaagtctgtcttgatcagtctagtgaccattggaagccagtcggtacaaca
gacggtttgagcaaacgggtcgatggtctccttcctgatggcgtgtacagtttccgcgta
tccgctcgcaacgaggcggagaaggtcagcattccattgtattccgaaatttacaaaccg
gcgtcccctgttgcaccgcctggggctccagtcgggccacttgtagctcgcagtatcgga
attggacaaattcagctagactggaagtctccacaggttggtggtccgcatggatatggt
gtaccggaggaatatttgattgaacgttacgactcaaagagagcgcgttgggcatatgtt
gctcggcaaccagtcagtgatggaacgagtattgtggtcacgggtctacaatctggtgga
gaataccgcttccgtgtgcgtgcagaaaatcgcgccggagcaggtccagccttggagatg
gaaaagccagtaattgccacaagtccattcagtcctcccggtgcaccagttggccccatc
aatatatcagaggtacagaaaggtccaagcaaatctgacggctcggtgcggttgtcatgg
cggcctcccgctgacaccggtggacttccagtccaacggtatgttacacaaatgcgttat
gcaaacacgcctggatggcaccggattggtcgaaggcaggccagtttagatgaggcacag
cagcttgatgacgaactggctgtgccgactacgacactggcaacgagcctgatgcaagga
cagcgttatgtttttcgagttgccgctgttaatgctgcagggactggtcctttcctggag
tcggatgtcttcgaaatgcctgaagacgaaagctgcagacccaaagcagactgggttcga
gttgtggggaagtccgcagatagcgtcacggttgaatggctcgttccacatgactgtcgc
catgaccatggacctcatcgtgcacaccatctagcgatcgataacttccgagtgtttgtc
cgtcctgcaacaccagcaggagcaccggaggctccgtggaaacgagtggccgatttggac
cactatatgaatcgtttggttgttggagatttgcgtcaggaccgtagttactacttcgga
gtagctgctgtaaatcaggctggtcaaggggatatcgtttccaccaaagaaccagtatct
cccgaggtgatcaccacggtccccagtcagcccgtcggtccacttcgtgcccatgatatc
acagatgttgggtgtacactcacttggtcaagtccagtaagcgatggaggaagtccattg
ttgggctatcgaatctacaagcgtgaaatgtatcgccgaagctggcaagaaattggccga
ctaactgaaacacctggtttgccgaccgctaagcagctgtcatttgcagttcaatatctg
atgcaggcaacgagctacgaattccgtgttgtggctgagaataagaatggtctttccgaa
ccactagacacacatgtgaatattcatcctgcaaaggcaaccgatgttccaggccctccg
cgaggacctttgagagtacgtgaactgccggaagaaaccggtaccttggagctctcttgg
gctccacccactgaaagtggtggcttaccaattctcggataccaattagaggttcgcgaa
ggtcgttcatttaattggaaaccatgcccctcggattctcagcttgtcgcagtcgggcct
gaacacaaacatcagccctctcatatcgtctccggaattcaacctaaccgagaatatttc
ttccgtgtgtccgcggtaaacaaagaaggcatgggccacccgttggttgcagaagacagt
tatgtaaaacgattgaacttggctccaccaaagcgtgttcttggccgcagacttccacag
tcggaggatgaagcacgaacggtaaaatccatactacaagttgaatgggaattaccacgt
ccactaacacacgaaccacaaccaattggtttccaaatcgaaagactggataacgacgca
cgttcggctaactgggagatagtagactttttgcccatcagcgatgctagtcaaacttcg
ttcgttcaccaatctgtcgctcctcgggggactggtagctacaagttccgtgtttccact
gtgtatccggagggtaccagtcaaccagttatgaccggcgtcatcctcgcgagtgcacca
acatccagtcgcccggcttcggcagcttctcgagaggttctgccttcggttccatctgtt
cgacttctggaagatactgggttgggttacgagttagagtgggtccctccgaaaggccct
ggagcagatgccattcgcggatacagtattgaggattgggattccagacgacaaaagtgg
caaccggttatcgacattccaaaaagtggaccgctaaaagtttccgttgctgcacctact
gcacttgaaccagatcatcggatgcgaatcattagtcgtggtgatgtaggtcgctctgtc
ccgactgagtttagcttgcaaccattggtggacgagacacttcggagaccttctactccc
acgtcggccatggagtggaaaactctacccagcacaactgggtatcctcttacaactcct
cacgctccaaagtcaactgcagttctacccatgatggatgagagtgatttagaacttgcc
cttatcacaggggtggacaccggcacatcggaagttgaggatttcatccgtacacgacgt
caaatggcccaagatatggcccgtcgtgatctagcatcatccatgggacgtcgcagtgcg
atgagtcaacgttcatttgatcaagagttgttatggagaccagaatctaccattgatcga
atcccctccagagttagtacacgtacgccaacgtacggtatccgagtgcaaggccagttg
atcgctgaagaactaacaccaaattccgttcgacttagttggtcagacgatgcatttaga
ccatacgaagcgaggaagccggattcctatggcattgagaaatgggatactcgtcagggc
aaatggattaccgtggggcaggctaggccccgagctacagaatacattgttaaaggtctt
attccggatgacgaagggtggtggttccgagtagtcccacttgatcatgaaggaaagtca
tgtggtatcccactgcaaatggaatctcctttacatccgagaccacgacatgttacaatt
ccatcgtcagtttggggagttgaactgtctcctatctatgcaccaatcgaatgggaacaa
ggaacgatggaagttgcttggatgaaacccagtaatgatggtgggagcaatttgctggga
tatagactcattgtgtatgacgctgacgcacaagaagaccgggaaattatagttccaccg
aaccaaacaaacgtacgcatcacatcgcttaacgctatgcacgttcacaggatcacgatt
actgcatttaaccgcatcggagattccttgccggttacttccactgtaccaccacgtcca
gggacacaaggaatgccaccaacacctccacctcctgcagagttccgagcggacctcttt
ggagaaccatattctgaccaatctgtttgntccactgtcccaccacgtacagggacacca
gggatgccaccaacacctccaactcctgcagagttccgagcggacctctttggagaacca
tattctgaccaatctgtttgccagttatcttggcgtcctccttctagaatgactgcccct
attgatttttacttgatagaaaagtgggattcccaatcgaaacagtggattccattcaaa
aaagtgcccgaaggcacctacagtattgaaataccttacctacttgatgacgtagaatac
ggctttcgtatacgttctcaaaacatatccggttttagtcagccagtggcgatccagtcg
cgaataagacccggacttgccaaagagcaaggtccacacagaatgccgttgccaccagcg
aagccatctggaccactggagatgataccgacactggtacaagatgacactgcgacccgt
ctgcagaccgcaatcgatgcagcctatcgcacgatcgaattgaggtggcagccaacctca
atacgtgaagactcggaggatcgtgctgggccgaccagagcctatgtgatcgaggcgcga
agacgggaacaaaggacatgggctctgctttctcgcgtgccagtcacgcatggacaacgt
gtaaggatcatctttggcctggaacctgatttgtgggatcgcagagtttcagcttccctc
ggtcgaccatcttcagccttggcccagttaccagaatcagcatccgtcgatacactcgct
ctcggtctcttaggtactccctacactagtgtcctatccggtgaaccgaaagactatgaa
ttccgcgtcttggccgaaaacgaatttggacggagtgaaccattatatgcaacttcgtgg
tcgccaggtactgaaattcccagtcgactatctgaaacttcgttcagacaagccctaact
gatttggattatccacttccgagacctcgaggtccgatttatttgacaccacgtgtactg
gtctcacggcccagttcccgccttgaaagccgtgcaccagaccgagaagagtttgaaatc
agttggcaacctccctacgatactacgggtgtctcaggttacgaagtactctatcgcagt
ccctatgcaaatcgctggtatcctattgggaaaaccggggtgacagaaactagcctcatg
ctacccgcttcattattggaagagttccctactagtattcatgttggcatccgaactgtg
ggtgatcaattacgaggaagtagtagaagaccaacttctgatcgccttgaagaggtgctt
accattccaacggtttcgaaacatggtgtatccacgcatcatccaccgacagttgcagtc
cccgttgctgacgagttgtcaatactgaagcccactgaagtacgagccagtctctttcag
ccaacaccatccattcgtggttcagatgagatcattgtcgattggtctccgtcaagtctg
agacctcttagtgaacatgaacgggttcgagagacaagacgacccgaaaaatacgtgata
tttgcccgagaattagggaaatctgagtggaaagagattactcaggttcccggtttaaca
actaccacgcaactacagcgttctgcactgccaacagcgcgtgacattttccttggtgta
gcccctacggtgggatcacgaataggtccaattgtatccactctagacgctctccgacta
cccaaagatgtgggggccaccagtttacctttccgtgagatgccggcaacgattttacct
actgagcagtttattgttacaccggaaggaccagatgaagcgaaaatacagtggatacct
tcggctgatcttttagccaaactagatacatatccgatggtggattaccagttgcaagtc
agacgacccggcgatctaacctggagaccaattacagccgagagaacaggtattagcagc
cgacttatagaaacccccagtcaacctagtctgatgaacttcaaggttgaccacttgaaa
cctggtgaacgctttgagatacgaattgcagctagacctagtcccatggagactttgatg
ccgatcacagaagtgaccacttcacgattgattccaccctacgatatcccatcaagaccc
cgaggcccgttagtagctgatttcattcgtaccaaagcacccgcacatattaggccttct
tccacactggacagcttcgaaatcgacaaatccgtttccagtctactcggacgtacaaca
tcaaaacttcctgaagatactgcagttcagttgtcttggcacgccccagtggacactggc
gggttacctgtcaccgaatatgtgattgaacgtcgcggtggcccagtttctgctcttgcg
cgtgactgggttcaggtgctcactgtaccaggcacacagactagagcactggttccgtca
ccatgggttacgtatcaaacatctacaccatactcctatcgtgtgagagcggtcaatcgc
atgggtgctagcagtcctttggaaacagccagacccttacagatagaagacatgagccct
tcggcaccctccagcagaccctcatctcgtgtcacctaccacctacaaccaccacttgca
ccccggggtccactgcgttctgagctactgccatacggttccggtgttcaactagaatgg
ttgcccccgcttctggatgggtttggggtgggtgaaacctattcccacccagcaacctat
gttattgaggctgctgaggctgacaaaccagatgctcaatgggttgaactgggtcgagtg
cccggaacgctttcctctgcagtagtacctttgcttccgccttctcggttccgaactgag
tccggagaccgcttcaccgctattgaagatgaatgggccacatacaagcccgccccagta
ttgtatcgcgtaagagccgagaatgagtttggtctcagtgctcccttggtcactagaatt
gaacctgttcttgaccgggaccttcgcacccgcttgccgcgatttcagccgggtcaattc
attgctcgcgttatatctgaaaccagtgttgagcagcctcctcagatagagctgcgctgg
ccacagctggcgcgctccgcgcctgctctggcaacccgaattggccgtcctgcgtttgaa
cctgctgttacatcagatcttggttatttgttagaagctagacgtgtcggtgagtttgga
tggcatccaataggcactttgccgattggacaagaatcatttgtctaccgccccacaaca
tacgactaccacgttccacggtcacgttctgctctagatgcaggccactatagagtagag
ccaacaccaactgttccgccatcttcagtagaagcatatcaattccgagttgctcctatc
acttcgcgcgagactggcgactttctagaatccgacattgtaagttggactgcgccgcta
cggagtgcgacaaaacccgcagattatcgcagagttcacacaccgttacctgttgcaatg
cacattactccaccgagctttagtggtccagttttaccatcaccagaacgattccagcta
gttgatatttcagttgaaaaaccagtggatggagtacccgaagatgccaatttcggaagt
gttgtgttgcgctggcgtccacccatcggtatgccatccacgatgcgttcagcagccgat
ttcgtggttgagtcatggcgaccggatcgtcaacagtggtggccagtggcacgatgtccg
gctgcgataactgcggaaaccgtacctggccgatatgatatacgaatcgcagggttgccc
gtaaatcaactttatcacttccgagtgctcacccagacaactgattcacaaagcgaaccc
gcgcttcttccacagcccgtctggataccaagagttgacgcggaaaaaagggctatacct
gaaccacccaaacgtcttcgagtcgcacccctgattggagactctccaggtgtgttattg
acttggctgccaccaacgacattcagcatggaagacttcataccgtccactttacgtcgt
tccactgtgggctattcagcacctccagctggttatctgattgagtatcagacggtttcg
gacagaaccggggaactttcaacgtggaaacatttggctgaattagaatcgtggcaaacg
cgatttgaagcgcgtgatttagaaccgggaaaacagtacattttccgtgtcacgtctatt
ggacatggtcccgacagattgaaaacatcgatactctcaagacgttcatcccgtgcagcg
cccctacttagtgaaccagtccagaccgaaccctacaaagtgccatctacaaaactatcc
acgatacgcctaaccggtgaactgttggttgaaccagtcactcgctacaccaagactcca
tcagtttccttgacttgggttcccagcaaagagcctctcagtggatacgttgttgatctc
tatgatctcgatctacctactgggtggcagacagtggcgcgtatcccagccacagattta
caggccccgttctctggagtgactgtcggtgatctaattccgggacattcctatcgattc
cgggtgctaccctatagagacgatatttacgggaaacctattcaaactatgcggctgtac
accgtcccagaatctcgtcacgaagcacaggaggatctcacatttgatcgaattcaactt
cccgcaccacagggtcctctgcgtgttgatagactgtcctccgatatctgtcgcctgagc
tggagggcaccccgtttaccattaagcatcgagccaacccggcgtgagaggctggaaagt
caatttgaatatgttattgagcaacgcttacctcataggcgtatgtggtatgaagtaggt
cgaactagggagctgcactacctcaccccgttagacacaaccagtcagttccgaatccga
acaatattttcggaagtctcggagcatgaagcaaaacacacattcgccttgtcttacgat
agcctcaagtcagattgggtcactgtcagggagggtgtggaggatgtatattaccggact
gccaaaaggaggcgttctgcggacactgaattcgaccttggaaatttcgttcctgataga
ctcattgcgaaacatattgggcgaacgtcagttctcctggaatggacggctaatgaattg
aaagtgccgacttacggctatatgttattagagaagagactcattgatcaacacaggttg
ggaatctgggagcccgtcgctcgaataccttggactccaggaaccacaagttatgaagtc
ctcggattgagatcaggttcatcttatgaatttcgtcttcttggagtggatgaacagact
ggagcgagaagtaccaaggtggcttatctaccgtctgcaatcactacgggtggtttcgca
gagacgtctgaagcagctctcgtcacctggttgaccgctccaaggcgcctccgggctcat
gtgaggtccgacaatgctgaagagggcatacaacttacttggttgccaccagagctttct
gatcaggcattaacgcgagttcgatacaaactagaggctagagaggtcgattcgtccggc
tctttgattaccgactggttggttgtaagtaaggatattgctcgaactgagtactacgtc
tcccgggctaaagtggatgagatgagttcgaaagcagttgctctggaatcccgcgatctt
ttgccaggtaaaaagcggcgaccagtcagctccatggatttagagagacgtcaatggcaa
tttcgggtgacggccagttgcgataaggcagaaagtgttccagcagtgatccaggaacca
atcgcaatcgtaccaccaaagcgacgtgtgccaatacgcttccttaatctcaaggaggac
agaataatctactccgttcttggtcagcgcctcgtcattactgtggaagttgaaggggag
cccacaccgtcggtagcttggtacctgaatcacatccgactggacgatcggatttcttcg
gattatcgcgttggtcgagtcggagccggagtgttcgaactgacgatcgacagggttcaa
agaaatcatgcaggtttactggagtgccgtgcatggaacgcttatgaaatggtttcaaac
aagtgggaaattgtggtggcagccgtaccacgcttcagtcgtttcgactggtcgttggac
gtgcgcgagttcgaggtaaaacatggcgatagttgggagctacgcatcccattagaagac
tgggactgtactcagggtcatgaatggataactaaagtttggttggagcgactgactcgc
atacctgcacttgccgacaccgggaagttccccgagtcactggaatctcgggttcgactt
cgaatcatcgaaggacttcgctgggtcgaacttttggtcgattcgatcagccttactgat
gcaggtgtctacagattatggattcaaaaccaagctggtcgcgactacctcgatttccga
cttcgtgtagctgataaaccacatgttcgtccgaataaacccagggtgcttcctcacgga
ccgggtaccctcgtcatttactgggatataccactccctaccagtcgtttggaggccgaa
attaagtacactggctaccgagttgagtatcgtcgtgaacaaccaggtgcatcatggaac
ttcctcggaagtacaccggctgagcaaacacaaatcctggtacggagcccgttagagcca
gaggtgacctatcgcttccgtgtctgtctcgaaaactggcatggttatggtccagccagc
gaaccatccgatcctgttcaactgccgacgcatagtattacagatgtctacgatgtcatg
gacgaggtgcttccatatgccgatgggtcctttgaatcccgctatacgatcatggaggaa
cttgctcgaacaaaacacgccggcctgtatcgtcttgttgaaaaatctaccggccgctcc
tacctggccaaaattgtggacacttcgagaggctccacagagaggttgcataccagtgct
cttggctatcgatcggaacaggcacgacgagatagtttgccaccaagaccagtgagtgcc
atggacactggtcgtctgatggatcgacgagtgacctctcaactgagtttgagtagaacc
agcttaacagattcggatgaatggaggcgacaacgaaccgaacaggaactaaagctgctc
accaaaatacagcatggagcacttgcgaagttccacgaggcttatcaagatgcaagacga
accgttgcgattatggaagatgtaactgcaggtggcaccttatggcaccagttgagtcat
cggatcacaatgacggaaaccaaggcggccgaaatactacgtcaacttctagatctgaca
aaccaactgcatcgttcgggattcgttcatctcggtttgcagatttactatattgctttc
gacttaaacaggacaactggtgatacggaaggtcccccggaactaacacgcatggagcga
cttcagttgtcaccgaaaatggttaaattcacaaaacgtctgttacatccagatccatcc
aaaagaccgacagccgccgaagccttgcgagacccatggttaacttcgattacaacgcaa
gcggaacccaggccatcagttacttcattaactggtcgacagcgtttatctggggagagc
ctgattgacgaagatttattaacgcataatgttgccgagagcatcagcaaacaagcatac
acacgtctgttgcgctggattgatgctagtcatgctgcagagcaggatgagagagaggtg
gaagagttaatctctgtacgtcgtcgccgtcattctcaacagtacctgagagagatggaa
acagaggttttcgaatctcggaaagatatagtcgttcacgcgcatgttaccgccagaggt
caagccccggagatcctcactccaatgggaagcgtcagtgtggaggagggtgggccagca
gtactaaagtgtgcagtacatttgcctcgcccacgtaagtccacaactcctttggatcga
atgtcaaacctgaaaatatactggtacttgaacggccgagagttgaagttatcggaacca
acggtcaaactgacccaaccacaaaggcagcactacatgtgtacttttgacccggacact
ggagatgtcaggctacacatcgatgaggtgaccacctatgacgctggaacatacgaagtt
agggtcgtcggtcagtacggtgaagtatccgattcggccaaccttcgtgtatatgcagcc
ccacatagaccatcaagccgaatagagcttcaggcctctgaagagttgggggcgcgtatt
ctcttgcctttggtggacgtgtcagcagctagcgggaaccgaatacaattgaaggctaag
gtggctggaataccacttccgcgttgcacctggctacacaatggtgtgcctctagttgct
tcaacccgaagacgattttatcaagaagaaacgggtgggctccacagctcagagcttcag
ttgactttggaattggtcagtctgaatacagctgactccggtctatacacattggttgcg
acgaacaaacacggctctcagtcatgttcggccgttgttgatgttctgggcacgctaaac
gaagactatgaggcgcctcattttcttgttgaactcacgagtaccactgtggtcgaaggc
agcgctgctcgcttcgaggcctgtgttcgcggtcaacctgcaccgacagttcgatggctg
aaagacggtaaaccgttactgaccgatggaatccggctgactgtgtcacagtcgtctacc
gagcgatcaaccacaaacaccacaagccacacattacttgtaagagatgccctacttcga
gatagtgggacttacacatgcatcgctaccagtgctgccggaacagctatcacggaggca
gctctgcatgtacgaggcttgttcaatcgcggaatgccaggtggatcggagtcactgggt
attcgtcaccgcttacccgaattcacccgtcgtttgcgtaatcagcaaatcgtgcttgga
gggaatatccgacttgctgcttctgtactagcccaaccatcggcaactgtgatctggcaa
agggacggagtagagatcaacactaacttggaaccaaggataacggctaaaaatcaaagc
ggacatcttgagcttgtgattgagaacgtgacaagagaagatctaggtcagtatacagtg
attgcatacaacgctgcgggtgaagctcgttgctcttgtgtgttgtccgtgttggaggaa
catcaattccgcttgcctcagttcacgcgcgaactccgtgatcacacagtgctcgaaggg
aacaacatattcctggaagcgattgcaactggagaacctcctccagatttcaaatgggag
aaggatggattcgaaatattgcctgacggcatcgacgcacaacgaatcgtgccaagtgtc
aatggccttggtcatgcttgcctaaccatcactaaggctcggctatcagacgccggcctc
tatcggtgcatagcacataatcgttacggacgtgagcgctgcacggcgtttgtctacgtg
gaagcaatcggacgacgagggtcgacagatcgtcatgctctgggaacgggtcttcctctt
ggccgtggtcgctctcttcccccagtcggttcgggcaggtacgctcctggcacagaccgt
cccccgtccctccctcgattgactgaggatgaaatatccactcgacggcaagggtcctcc
atatctccgaaacccgatggatatttgagcgtcatacgtcctctgccaagccacattcaa
gtcgaagaaggcgatacccttaacttaacctgtttagtcagttcaaacattcattacata
cgtgcaaaatctgcatcgtcgggacaccccgtgatcaccctaccctaccctgaacacatc
tgctgcgacctccctaatctccccgatgccctaggaattcgtcgcccttcaactgacttg
tcctacattagcagtccaaccctgaacaatacaacggtgcttctccactcaaaatgttta
atttga

DBGET integrated database retrieval system