KEGG   Opisthorchis viverrini: T265_04511Help
Entry
T265_04511        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    T265_04511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovi01001]
    T265_04511
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ovi03036]
    T265_04511
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     T265_04511
Protein kinases [BR:ovi01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   T265_04511
Chromosome and associated proteins [BR:ovi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     T265_04511
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    T265_04511
  Sister chromatid separation proteins
   Polo kinases
    T265_04511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 20318693
NCBI-ProteinID: XP_009167530
UniProt: A0A074ZMX0
Position
Unknown
AA seq 661 aa AA seqDB search
MGILDYDIPFPNGAKDNGSFKGYRWLGSTFRLLNVSKEPYYTRQIVVPLHVDRIQQFWHP
FKIVRCENFEPMTVIDRRTNEKGYNFLCYELIDQATQERFAGKVVPKSALVKSSQKEKMQ
QEICIHRTLKHENVVGFHGYFEDVDFIYIVLELCNRRSLLELHKRRRFLSEPEARYFMRQ
IINGCQYLHRNKVMHRDLKLANLFLNDDLVIKIGDFGLASRIVNEGEKKRTLCGTPNYIA
PEVLTKGGHSFEVDCWSLGCILYTLLVGNPPFETNKLEETYARIKMNEYKIPIRVSASAS
KFIRALLNKDPSKRPSMFTMLEDDFFKEYTPTSLPVSALTTCPRFDSIVTPQIGRRPLSD
INPLEDIPITHGGGTVVKSTASIDNQPGDCWLEKLKQELNLLMTEAKILRDNTVKAMEDS
EDPACCPIYWVSKWVDYSDKYGLGYQLCDNSSGVVFNDVTRLILAANLQNLQYIDQDGTE
SFFTMTTHPPVLEKKITLLNYFKSYMQENLLKAGENVARRDSDDLARLPFLRRWFRTRSA
MVLHLSNGTLQINFFEDHAKIILCPLMRAVTYIDSNRDFKTYQFQMLQTGGIIQDLLKRL
EYAKTMIDTLTASLPQGGPSSTKSAPNDGNAKPNAPIQSAVRKTTATATGPPAPATGKLT
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggtattctggactatgatataccttttccgaacggcgccaaagataatggatctttc
aagggatatcgatggctaggtagtacgtttaggctgctgaacgtgtcaaaggaaccttac
tacacacgacaaattgtggtaccactacacgtcgacagaattcagcaattctggcatcct
ttcaagatagtgcggtgtgaaaattttgaaccgatgacagttattgatagaaggacgaac
gagaaaggatataactttttgtgctatgagctgatcgaccaagctactcaagaaaggttt
gcagggaaggttgtccctaaatcagctcttgtgaaatcttctcagaaagagaagatgcaa
caggaaatatgtattcacaggacactaaagcatgagaacgttgttgggtttcatggctat
tttgaagacgtcgattttatctatattgtcttggagttgtgtaatagacggtcactcttg
gaactgcacaaacggcgacgcttcctttctgaaccagaagcccgatattttatgaggcaa
atcatcaacgggtgtcagtaccttcacaggaataaagttatgcatcgagatctcaaactt
gccaatcttttccttaatgatgacttagtcatcaagattggtgacttcgggctggcctcc
cgaatcgtcaacgaaggagagaaaaaaaggacgctatgtggcacacccaactacatcgct
cctgaagtacttactaaggggggacatagcttcgaagtggattgctggtccttgggttgt
atattgtacactttgcttgttggcaacccaccattcgaaacaaacaagctcgaggaaacc
tacgctcggataaaaatgaacgaatataagataccgatccgtgtttctgcgtctgcctcg
aaattcatacgtgcactcctgaataaggacccgtccaaaaggccaagcatgttcactatg
ctggaagacgatttcttcaaagaatacacaccgacttcccttccagttagcgctttgaca
acgtgcccacggttcgattcgattgttactcctcagatcgggcgccgcccgctttctgat
attaatcccttagaggatattcctattacacatggcggcggcacggtcgtcaaaagcact
gcatctattgataatcagcccggagactgctggcttgagaaactgaagcaagaacttaat
ttactaatgaccgaagccaaaattctgagggacaatactgtgaaagccatggaagatagt
gaagatccggcctgttgccccatatactgggtcagcaagtgggttgactattcagacaaa
tacggactgggatatcaactttgtgataactcaagcggggttgttttcaatgatgtcacc
cgcctgatattagccgccaacctgcaaaatttacagtatatagatcaagatggaacggaa
agcttctttaccatgacaacacatcctcccgttctcgaaaagaagatcactctgttgaat
tacttcaagtcttacatgcaggaaaatctccttaaagcaggcgaaaacgttgctcgtcgt
gactcggatgacttggcgcgactgccctttctacgtcggtggttccgtacccgttccgct
atggttttacacctgagcaatggcacactccagatcaatttcttcgaggatcatgcgaaa
atcattctctgtcccctgatgcgtgccgtgacgtatattgactcgaatcgtgattttaag
acctaccaattccaaatgcttcaaaccggtggtataattcaagatctcctcaagcgattg
gagtacgctaagaccatgattgacactttgaccgcatccctaccgcagggtggtccgtcc
tccacaaagtctgcgccgaacgatgggaatgctaagcctaatgcaccaatccagtctgct
gttcgaaaaacgacggccacagcaacaggccccccagctccggctacggggaagctgact
aagtga

DBGET integrated database retrieval system