KEGG   Opisthorchis viverrini: T265_06150Help
Entry
T265_06150        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ovi03019]
    T265_06150
Enzymes [BR:ovi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     T265_06150
Messenger RNA biogenesis [BR:ovi03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     T265_06150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF4498
Motif
Other DBs
NCBI-GeneID: 20320332
NCBI-ProteinID: XP_009169607
UniProt: A0A074ZHF2
Position
Unknown
AA seq 725 aa AA seqDB search
MEQYEHEQSKPDCSSQNSFALLDEANSRFRVWQSRQAKRRQLLQQYSVPSVTAVEEDHPH
SAKPITQYQRNLGDFDEAAYRKRFILPVISRLRLPTLSRRLRNRIKRLLRDHFGLAGVHT
SQQLHQLGLLFPKLATLPPCVSGESLKPSLESNKTTRSAGGAKLNDGELIDSFAGQAVGN
DDLLIKTYTGSATFLKGTQSANPHNDYCQHFVDTGERPQNFIRDTGLRNRFEEYPKLREL
IRLKDELIQTKATPPMYLKADLKTFDLNELHSKFDVVLVEPPLEEYHRMNGAVFDQHWTW
DEIERLEIEQIIAPRAFVWIWCGSGEGLDAARRCLRKWGFRRCEDICWIKTNHGRPGHEA
LEPGAVFQRTKEHCLMGIHGTVRRSTDGDFIHANIDIDLIIEDAPKYGSYTAKDKPTEIF
HIIEHFCLGRRRLHLFGRDSTLRAGWLTVGNELSASNFDHRLYAANFTKDPNGSLLGTTE
EVERLRPKSPPPRHSSNPSTAVNPVGAKSQELTGLAGTTITTTHSRNLLQTLPVSKTSNV
ELSGYAGRRLGLGGSLKLHGSGGLQPSLLGLPSPMPIDGFPGSSRSTFSTRDRSALTATS
TCLNTIPSRNITIDVQPNASNQQASLLSSLWPPAATNSLTMALAAASQTQLFGAGTLGSS
VLRPSVVNAPLVSSLLNTGKVTPAMLAALTAATSSLNLPAFTDPVRALGQNLSSFHRGHH
ANWHQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatacgaacacgaacaatcgaaaccagattgcagtagtcaaaactcgtttgcg
ctgctggacgaggcgaattcccgatttcgggtttggcagtcccgtcaagccaagcgacgc
cagctactccagcagtactctgtaccatccgttacagcggttgaggaagaccatccccac
tcagcaaaaccgattacacagtaccagaggaacttgggggactttgatgaggcagcttat
cgcaagcgatttattctaccagtaatatcccgcctcagattacctacactgagcagacgt
ttacgtaacagaataaagcgccttctacgggaccattttggactggctggtgtccacaca
tctcagcaactacatcaactaggcttactttttcctaagttagccacacttcctccgtgt
gtttcgggggagtcgctcaaaccaagcttggagtcaaacaaaacgacccgatctgcaggt
ggtgcaaaactcaatgatggagagcttatcgattcttttgccggtcaggcagtgggtaat
gatgacttgctgatcaaaacctacactggttctgctaccttcctcaaaggaacccagagt
gcgaatccacataacgactactgtcaacacttcgtcgataccggtgaacgtccacaaaat
ttcattcgggataccggtctgcgtaatcggtttgaagaatatccgaaattacgggaactg
atacgacttaaggatgaattgatacagacgaaggccactccgccaatgtatttgaaggcc
gatttaaagacatttgatttgaatgaacttcactctaaatttgatgttgtcctggtcgaa
ccacctttagaggaataccatcgtatgaacggtgcagtatttgatcagcactggacctgg
gatgagattgaacggttggaaattgaacaaattatagctccgcgcgcatttgtgtggata
tggtgtggatcaggtgaaggattggatgctgctcgaaggtgcttacgaaagtggggcttc
cggcgttgtgaagatatttgctggatcaaaaccaaccacggtcgtccaggacacgaggct
ctggaacccggtgctgtatttcaacgtacaaaggagcactgcctcatgggaatccacggc
accgtccggcgctctaccgacggcgatttcatccatgccaacattgatattgatttgatc
attgaagatgcaccgaaatatggtagctacacggcgaaggataaaccaactgaaatattc
cacattatcgaacacttttgtctgggacgtcgtcgtttgcatctttttggacgtgacagt
actctgcgtgctggatggcttactgtcggaaatgaactctcggcgtccaacttcgatcac
cgtttgtatgcggctaatttcacaaaggatccaaatggatcgttactgggcaccacagag
gaagtcgaacgactccgaccaaaatccccgccacctcgacactcctccaacccatcgact
gcggtcaatccggtgggagccaagtcccaagaactaacgggcctcgcagggaccacgata
accacgacgcactcacggaacttgcttcagacactaccggttagcaagaccagtaacgtg
gagctttcaggctacgctggacgccggttaggtctcggtggctcattgaaacttcacggt
tcgggcggcttgcaaccgtcgttacttgggctaccttctcccatgccgattgacggtttt
cctggatcctcacgctcgacattcagtacgcgggaccggtcggctctgacagctacaagt
acctgcctcaatacaataccatcgcgcaatatcaccatcgatgtccaacccaacgcatca
aatcaacaagcaagcctcctatcttcactgtggcctccagctgctacaaacagtctgacc
atggcacttgcagcagccagtcagacacaactatttggtgccggtacacttgggtcatca
gtgctgcgtccgtctgtggtcaacgccccattggtttccagcttgttgaacaccggcaaa
gtgacacctgcgatgcttgctgctttgacagcggccacttcctcgcttaatttaccagct
tttactgaccctgtgagggccttgggacaaaatttatcaagcttccatcgaggtcatcat
gcaaattggcatcaatga

DBGET integrated database retrieval system