KEGG   Opisthorchis viverrini: T265_09663Help
Entry
T265_09663        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovi01001]
    T265_09663
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     T265_09663
Protein kinases [BR:ovi01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   T265_09663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 20323831
NCBI-ProteinID: XP_009174077
UniProt: A0A075A479
Position
Unknown
AA seq 340 aa AA seqDB search
MFRPKRTKVTNDYKITGSVLGTGVSGKVLKCVQLRTGTTYALKILEDSFASRREVELHWR
ASACPNVVRVVDVYENNNEHTSKKYLLMVMECMEGGELYSRIKSRSSFTESEAARIVHQI
ASAIHHLHTKSIAHQNLLFASKDPNSPLKLTDFGFAREVTMANSLKTPCYTPYYVAPEIL
NRVNYDKSCDLWSLGVITYILLCGFPPFYSKNGAPISPCMQRNIIYGNYDFPASHWAHVS
NEAKDLISRLLLTEPERRLSSAQVMQHPWVAKYTSVPDTPLTTTQFLSTTVWEHVNDAMT
KELRTMRLDVENVPHLLPVEQAKNPLLTKRKLKQDVDRNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtccgaagaggacgaaagttacaaatgactacaagattactggctccgttctg
ggtacgggtgtcagtgggaaagtcctcaaatgtgtccagcttcgcactggcaccacttac
gctttgaagatcttagaagactcgttcgcctccagacgtgaggttgaactacattggcgt
gcctcggcctgtcccaacgtagtccgagtggttgatgtatatgagaacaacaatgagcac
acatccaagaagtacctacttatggtaatggagtgcatggaaggaggcgaactgtacagc
cgaatcaaatcccgcagctctttcactgagtccgaagctgcacgaattgtccatcagatt
gcatcggccattcaccatttgcacacgaagagtatcgcacatcaaaacctcctcttcgcc
tccaaagatcctaattccccactaaaactgacggactttggctttgctcgggaagtgaca
atggcgaattcgttaaaaaccccttgctataccccttactatgttgcgcccgaaatcctc
aaccgagtgaattatgacaaatcttgtgacttatggtcgctcggtgtgatcacctacatt
ttattgtgtggatttcctcctttttacagcaaaaatggtgcgcccatttctccgtgtatg
caaaggaatattatttatggcaactacgatttccccgcctctcattgggcacatgtttcc
aatgaagccaaggacctcatcagccgcttgttgcttactgaaccagaaaggcgtctctca
agtgctcaagtgatgcagcacccttgggtcgccaagtatacatccgtacctgacacacct
ttgaccactactcagttcctatccaccaccgtgtgggaacacgtgaatgatgctatgacc
aaggaattgaggactatgcgactggacgtggagaacgtgcctcatctactgcccgtcgag
caggcgaagaatccgctcctaacaaagcgaaaactcaagcaagatgtcgataggaacaaa
taa

DBGET integrated database retrieval system