KEGG   Opisthorchis viverrini: T265_13484Help
Entry
T265_13484        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ovi01002]
    T265_13484
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovi04147]
    T265_13484
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     T265_13484
Peptidases [BR:ovi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   T265_13484
Exosome [BR:ovi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   T265_13484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_2 Abhydrolase_4 Peptidase_S15 COesterase
Motif
Other DBs
NCBI-GeneID: 20327651
NCBI-ProteinID: XP_009167329
UniProt: A0A075A076
Position
Unknown
AA seq 334 aa AA seqDB search
LFIILYLAVPYVLEKWPSFSHSFIFKPKNTSGDKHEYYTCFEQHRLSHKSTRNFYVETAD
SGDKLGVWHILPYESARAADGYEPCEDLFEHELHNNTPIFIYFHGNTKTRSVSWRIDKYK
LLSSLGYNVITFDYRGYGDSSGKMTGELDCVQDSMAILQYVYDHCNSSPVFFWGHSLGTA
VVGSLIRHITDAWEMSSSNCLPFPSGIILDAPFTALSQVIIGQKSMWPYRVVPPMRKKMV
SITRNLRMEFNTQENLTGCPVPLLILHAKDDPLVPYHLGEKLAKSLESTTDVTFVPFAAE
RGYRHNFIHTAPEIPDLIRNFVRSSLKKQLFEHI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttattcattattttgtacttggcggtgccatacgttttggagaaatggcccagtttttca
cattcattcatcttcaaacctaaaaacacctcgggcgacaaacatgagtactatacttgt
ttcgaacagcatcggctatcacacaagtcaacgagaaatttttatgtggagactgcagac
agcggtgacaaacttggagtatggcatatactgccgtacgagagtgcgcgcgccgcggac
ggctatgagccttgtgaagatctattcgaacatgaacttcacaataacacgcctattttt
atctactttcacggtaacacgaaaacgcggtcagtgtcttggcgtattgacaagtacaaa
ctgctttcgtctctcggttacaatgtgatcaccttcgactatcggggctacggggattct
agtggcaagatgactggcgagctagactgtgttcaagattctatggccattttgcagtat
gtctatgaccattgcaattcaagccctgtgttcttctggggtcactcacttggaaccgca
gtcgttgggtcactaattcgacatatcaccgatgcgtgggagatgtcctcttcgaattgt
cttccattcccaagcgggattattctggacgctccatttactgcactttcacaagtcatt
attggtcagaagtcgatgtggccttacagagtcgtgcctcctatgcgaaaaaagatggtt
tcaataaccagaaatttgcggatggaatttaacacacaggaaaatttaactggatgtccc
gtcccccttctaattctgcacgccaaagatgatcctttggtgccctatcatctaggtgaa
aagttggcaaagagcttggaatctaccactgacgtgacattcgtaccatttgcggctgaa
agaggataccgtcacaattttatacatacagctcccgaaattcctgacctcatcagaaat
tttgtccgcagttcattaaaaaaacaactgtttgagcacatctga

DBGET integrated database retrieval system